SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010021 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010021
Domain Number 1 Region: 25-187
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-18
Family SPRY domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010021   Gene: ENSSSCG00000009390   Transcript: ENSSSCT00000010289
Sequence length 196
Comment pep:known_by_projection chromosome:Sscrofa10.2:11:18186983:18208062:1 gene:ENSSSCG00000009390 transcript:ENSSSCT00000010289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSVFCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGTDVVIVKNGRRICGTGGCLASAPL
HQNKSYFEFKIQSTGIWGIGVATQKVNLNQIPLGRDVHSLVMRNDGALYHNNEEKNRLPA
NSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYH
TPPPGFEKILFEQQIF
Download sequence
Identical sequences F1RK24 L5M1J0
9823.ENSSSCP00000010021 ENSSSCP00000010021 NP_001230458.1.46622 XP_006761285.1.95426 ENSSSCP00000010021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]