SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010112 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010112
Domain Number 1 Region: 4-454
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 8.63e-117
Family 2-methylcitrate dehydratase PrpD 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010112   Gene: ENSSSCG00000009469   Transcript: ENSSSCT00000010382
Sequence length 471
Comment pep:known chromosome:Sscrofa10.2:11:53715642:53726372:1 gene:ENSSSCG00000009469 transcript:ENSSSCT00000010382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLKSVTESFAKVIHGLKVGHLTDHVIQRSKRMILDTLGVGFLGTSTEVFHKAGEYSKIY
SSSVSSTVWGRPDFRLPPTYAAFVNGVAIHSMDFDDTWYPATHPSGAVLPVLMALSEALP
PSPKCSGLDLLLAFNVGIEVQGRLMHFSKEANDIPKRFHPPSVVGTLGSAAAASKFLGLS
MRNCQDALAIAVSHAGAPMANAATQTKPLHIGNAARHGIEAVFLAMLGLQGNKQVLDMKT
GFGAFYANYSPKVLPDPDSHTWLLDQQDVAFKIFPAHLATHWVAEAAASVRKHLVRDSTL
LPIDHIERIVLRIPNVQYVNRPFPDSEHEARHSFQYVACATLLDGAIAVPSFHKCQIDRP
QVRELLGKVELEHPQDNLPNFDTMYCEISIVLKDGAIFTERSDTFYGHWRKPLSQRDLQE
KFRANATKALSCHTVEKLIKIVDNLEDLEDCSVLTALLKEHSLSEMVSKSI
Download sequence
Identical sequences F1RHE5
ENSSSCP00000010112 ENSSSCP00000010112 XP_005658501.2.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]