SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010205 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010205
Domain Number 1 Region: 144-174,227-467
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.98e-81
Family Eukaryotic proteases 0.0000000229
Further Details:      
 
Domain Number 2 Region: 40-103
Classification Level Classification E-value
Superfamily GLA-domain 1.4e-25
Family GLA-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010205   Gene: ENSSSCG00000009558   Transcript: ENSSSCT00000010477
Sequence length 479
Comment pep:known_by_projection chromosome:Sscrofa10.2:11:86197298:86213979:-1 gene:ENSSSCG00000009558 transcript:ENSSSCT00000010477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGLPSLVLLSASLAGLLLPGGSVFLPRDRAHSVLERARRANSFWEEMKKGNLERECLEE
TCSYEEAREVFEDQQKTDEFWNKYKDGDQCESSPCQNQGKCKDGLGEYNCTCAEGFEGKN
CELLTRKLCSLDNGDCDQFCREEQSSVVCSCASGYILGDNGKSCISTEPFPCGKRTLGRS
RRSADHGSEAAPEAGRSEQEPRDLGPTEGPLHLLSLNDTEPGPEEDEDESSLVRIVGGRD
CREGECPWQALLVNEENEGFCGGTILSEFHVLTAAHCLHQAKKFKVRVGDRNLEKEEGDE
AAHEVEVTVKHSRFVRETYDFDIAVLKLKTPITFRTNVAPACLPEKNWAEATLLTQKTGI
VSGFGRTHERGRPSSTLKMLEVPYVDRNTCKLSSSFLITPNMFCAGYDEQPEDACQGDSG
GPHVTRFRDTYFVTGIVSWGEGCARRGKYGVYTKVTNFLKWIERSMRARAEAGAEPHPQ
Download sequence
Identical sequences ENSSSCP00000010205 9823.ENSSSCP00000010205 ENSSSCP00000010205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]