SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010206 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010206
Domain Number 1 Region: 165-429
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.19e-77
Family Eukaryotic proteases 0.000000158
Further Details:      
 
Domain Number 2 Region: 38-101
Classification Level Classification E-value
Superfamily GLA-domain 8.44e-24
Family GLA-domain 0.00015
Further Details:      
 
Domain Number 3 Region: 129-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000885
Family EGF-type module 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010206   Gene: ENSSSCG00000029503   Transcript: ENSSSCT00000010478
Sequence length 445
Comment pep:known_by_projection chromosome:Sscrofa10.2:11:86217112:86223394:-1 gene:ENSSSCG00000029503 transcript:ENSSSCT00000010478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLRPALLCLLLCLQGSLAAVFVAQEQAHSLLHRFRRANSFLEELWPGSLERECREEQC
SFEEAREIFKSEERTRQFWVSYNDGDQCASNPCLNGGSCEDQLQAYICFCPEGFEGRNCE
TNKKSQLICMNDNGGCEQYCSDHAEAGRSCWCHEGYALQEDGVSCEPTVEYPCGKIPVLE
KRNDSNPQGRIVGGKVCPKGECPWQAMLKLKGALLCGGTLLNTSWVVSAAHCFDRIRSWK
DLTVVLGEHDLSKDEGDEQERPVAQVFVPDKYVPGKTDHDLALVRLARPVALTDHVVPLC
LPERSFSQRTMAFIRYSAVSSWDRLLDRGAKARVLMAIQVPRLMTQDCLEQARRRPGSPS
ITDNMFCAGYLDGSKDACKGDSGGPHATRFRGTWFLTGVVSWGEGCAATGRFGVYTRVSR
YTAWLLGLMSAPPPPSEGLLRAPLP
Download sequence
Identical sequences ENSSSCP00000010206 ENSSSCP00000010206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]