SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010214 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010214
Domain Number 1 Region: 252-440
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-37
Family Laminin G-like module 0.0000000306
Further Details:      
 
Domain Number 2 Region: 457-662
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-34
Family Laminin G-like module 0.000000156
Further Details:      
 
Domain Number 3 Region: 46-103
Classification Level Classification E-value
Superfamily GLA-domain 1.24e-19
Family GLA-domain 0.00069
Further Details:      
 
Domain Number 4 Region: 153-193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000176
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 5 Region: 115-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000175
Family EGF-type module 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010214   Gene: ENSSSCG00000009565   Transcript: ENSSSCT00000010486
Sequence length 666
Comment pep:known chromosome:Sscrofa10.2:11:86582119:86614652:-1 gene:ENSSSCG00000009565 transcript:ENSSSCT00000010486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LISLPGPPTRFDFNLYFLRLASESARTVMLRAREAAQFLRPRQRRAYQVFEEAKQGHLER
ECIEELCSQEEAREVFENDPETEYFYPRYLECISKHGSPYTKNPDFVSCVQKLPDQCSPD
PCDKEGTQVCQDLMGNFYCQCRDGWGGRLCDRDVNECSQQNGGCSHVCYNKLGSFHCACY
SGYALSPDSRTCHGWGTGRESCRDCTCPGMSTARSFLCRKQFLTAASFHLSAEVAEWMSA
QGRPLAGGPHDCSCPGQREEAEGREPEQDILPCVPFNVAKSVKSLYLGRMFSGTPVIRLR
FKRLQPTRLVAEFDFRTFDPEGVLFFAGGRQDSTWIVLGLRAGRLELQLRYQGVGRVTSS
GPVINHGVWQTISVEELERNLVVKVNRDAVMKIAVAGELFQLDRGLYHLNLTVGGIPFKE
KDLVQPMNPRLDGCMRSWNWLNGEDTTIQETVRVNAKMQCFSLTERGSFFPGTGFALYSL
DYARTSPDIGAETFWEVEAVARIRPATDTGVLLALVGGDQAVVLSVALVDYHSTKKLKKQ
LVVLAAESVTLALMEIKVCDGQEHVVTVSVNKDEATLEVDGTRGQRDVSPAGLQERLVLL
GRHLQGSVLTFIGGLPDVPVTSAPVTAFYRGCMTLEVNGKALDLDEATYKHSDITAHSCP
PVEPAA
Download sequence
Identical sequences ENSSSCP00000010214 ENSSSCP00000010214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]