SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010242 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010242
Domain Number 1 Region: 386-687
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.2e-72
Family Protein kinases, catalytic subunit 0.000000442
Further Details:      
 
Domain Number 2 Region: 222-344
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-35
Family Kringle modules 0.00025
Further Details:      
 
Domain Number 3 Region: 11-98
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-21
Family I set domains 0.023
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000010242
Domain Number - Region: 116-203
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0392
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010242   Gene: ENSSSCG00000009593   Transcript: ENSSSCT00000010515
Sequence length 885
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:3602843:3643321:-1 gene:ENSSSCG00000009593 transcript:ENSSSCT00000010515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPSVRWLKNDAPVVQEPRRVIIRKTEYGS
RLRIQDLDTTDTGYYQCVATNGVKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYR
GIACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFVFPL
CDARSRAPKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAA
NCMRIGIPAERLGRYHQCYNGSGTDYRGTASTTKSGHQCQPWALQHPHSHHLTSADFPEL
GGGHAYCRNPGGQMEGPWCFTQNKNVRMELCDVPSCSPQDSSRMGILYILVPSIAIPLVI
ACLFFLVCMCRNKQKASASTPQRRQLMASPSQDVEMPLINQHKQAKLKEISLSTVRFMEE
LGEDRFGKVYKGHLFGPAPGEQTQAVAIKTLKDKAEGPLREEFRHEALLRARLQHPNIVC
LLGVVTKDQPLSMIFSYCPHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHVVAQ
IAAGMEYLSSHHVVHKDLATRNVLVYDKLTVKISDLGLFREVYSADYYKLTGSALLPIRW
MSPEAIMYGKFSVDSDIWSYGVVLWEVFSYGLQPYCGHSNQDVVEMVRSRQVLPCPDDCP
AWVYALMVECWHEFPSRRPRFKDIHSRLRAWGNLSTYNSSAQTSGASNATQTSSLSTSPV
SNVSNARYGGPKQKAQPFPQPQFIPVKGQIRPMVPAPQLYIPVNGYQPVPAYGAYLPNFY
PVQIPMQMAPQQVPAQMVPKPGSHHSGSGSTSTGYVTTAPSNTSVADRAALLAEGTEDAQ
NVPEDVAQSPVQEAEEEEDGSVPETELLGDNDALQMDEAEVQLEA
Download sequence
Identical sequences ENSSSCP00000010242 ENSSSCP00000010242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]