SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010270 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010270
Domain Number 1 Region: 146-340
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.98e-57
Family Astacin 0.0001
Further Details:      
 
Domain Number 2 Region: 769-880
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-38
Family Spermadhesin, CUB domain 0.00018
Further Details:      
 
Domain Number 3 Region: 463-565
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.15e-36
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 4 Region: 614-724
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-36
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 5 Region: 347-456
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-36
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 6 Region: 905-998
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-30
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 7 Region: 573-610,725-771
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000832
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010270   Gene: ENSSSCG00000009620   Transcript: ENSSSCT00000010546
Sequence length 1009
Comment pep:known chromosome:Sscrofa10.2:14:6881426:6923145:1 gene:ENSSSCG00000009620 transcript:ENSSSCT00000010546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VARPPLPLLLWLLLLARPGRPLDLADYTYDLGEEDDAEPLNYKDPCKAAAFLGDIALDEE
DLRAFQVQQAADLRQRTTRKSSIKAAGTLALPQSSSKCRRTQELCTRILFGNSSTLQCQS
TRGQPQRRSHGKWRSRSRSRRAATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWE
KHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVI
GFWHEHTRPDRDRQACIVCENIHTRQEYNFLKMEVQEVESLGETYDFDSIMHYARNTFSR
GIFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYP
NGYSAHMHCVWRISVTPGEKIILNFTSMDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGG
KLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGGDVKKDNGHIQSPNYPDDYRPSK
VCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIK
STSSRLWLKFVSDGSINKAGFAVNFFKAAEVDECSRPNRGGCEQRCLNTLGSYKCSCDPG
YELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFE
TEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFK
AHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGT
ITSPNWPDKYPSKKECTWAISSTPGHRVKLTFLEMDIESQPECAYDHLEVYDGRDAKAPV
LGRFCGSKKPEPVLATGSRMFLRFYSDNSVQRKGFQAAHSTECGGQVRAEVKTKDLYSHA
QFGDNNYPGGVDCEWVIVAEEGYGVELVFQTFEVEEETDCGYDYMELFDGYDSTAPRLGR
YCGSGPPEEVYSAGDSVLVKFHSDDTITKKGFHLRYTSTKFQDTLHSRK
Download sequence
Identical sequences ENSSSCP00000010270 ENSSSCP00000010270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]