SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010361 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010361
Domain Number 1 Region: 136-312
Classification Level Classification E-value
Superfamily Sec7 domain 7.33e-46
Family Sec7 domain 0.0000983
Further Details:      
 
Domain Number 2 Region: 62-139
Classification Level Classification E-value
Superfamily F-box domain 5.76e-16
Family F-box domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010361   Gene: ENSSSCG00000009702   Transcript: ENSSSCT00000010637
Sequence length 319
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:16990964:17077559:1 gene:ENSSSCG00000009702 transcript:ENSSSCT00000010637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQGLWRVVRNQQLQQEGYSEQGYLSREQSRRMAASSISNTSHRKQVQGGIDIYHLLKTR
KSKEQEGFINLEMLPPELSFTILSYLNATDLCLASCVWQDLANDELLWQGLCKSTWGHCS
IYNKNPPLGFSFRKLYMQLDEGSLTFNANPDEGVNYFMSKGILDDSPKEIAKFIFCTRTL
NWKKLRIYLDERRDVLDDLVTLHNFRNQFLPNALREFFRHIHAPEERGEYLETLITKFSH
RFCACNPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVKNKMSKREFIRNTRRAAQNIS
EDFVGHLYDNIYLIGHVAA
Download sequence
Identical sequences F1RJ03
9823.ENSSSCP00000010361 ENSSSCP00000010361 ENSSSCP00000010361 XP_003132883.1.46622 XP_020929863.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]