SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010407 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010407
Domain Number 1 Region: 91-277
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.58e-23
Family Pentraxin (pentaxin) 0.023
Further Details:      
 
Domain Number 2 Region: 594-856
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000137
Family Rhodopsin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010407   Gene: ENSSSCG00000009745   Transcript: ENSSSCT00000010684
Sequence length 906
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:25517652:25788741:-1 gene:ENSSSCG00000009745 transcript:ENSSSCT00000010684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKLLPLCCWHSWLLLFYCDFQVHGADARSQAHPGFEVLASASYYWPLENVDGIHELQET
TGALRTHNLTVLPSHNSTFVYTNGSAYSNFSATVDIVEGKVNKGIYLKGEKGITLLYFGE
YKPSCIFNPAQCSPEGVTFSFFWKIQGEQSRSAPFAYGGQVISNLFKVCSRGGKGSVELY
THDNSMTWEATFSPPGPYWTHVLFTWKFKEGLKVYVNGTLSNSDPSGKEAHAYGEPNANL
VIGSEQDQTKRYDNGAFDEFIIWERALTPDEIAMYFTAAVGKHVLLSSASPNFFMTPTAN
TMVPTDAYHPIITNLTEERKNFQSPGIVLNYLQNVSLSLPNKFLSEETALNLTKTFLKAM
GEVLHLPSWSAVSEDGTMVLGLIETVEAVMSHISSNLQPREAHVTIVGSSSMADFSVARL
LPKTLNSSHYRFPARGQNYIEIPHVAFHSQAWTTIVGLLYHSMHYYLSHIQPADTRIAEA
TKYKNCLLSATSYLISLEASPSPKLSQNLSGSPLITIRLRHHLTQRQYIEATNESNRIFL
YCAFLDFSSGEGVWSNQGCGLVEGNLSYSVCRCTHLTNFAILMQVVPLELTHGHQVALSS
ISYIGCSLSVLCLAVTLVTFAVLSSVSTIRNQRYHIHANLSFAVLVAQVLLLVSFQFEPG
TTPCQVLAVFLHYFFLSAFAWMLVEGLHLYSMVIKVFGSEDSKHRYYYGIGWGFPLLICI
ISTVFAMDSYGTSKNCWLSLGSGAIWAFVAPALFIIVVNIGILIAVTRVISQISADNYKI
HGDPSAFKLTAKAVAVLLPILGTSWLFGVLAVNSEAVVFQYMFAILNSLQGFFIFLFHCL
LNSEVRAAFKHKTKVWSLTSSSTRQANMKPFSSDIMNGTRPGTGSSRLSPWDKSSHSAHR
VDLSAV
Download sequence
Identical sequences ENSSSCP00000010407 ENSSSCP00000010407 9823.ENSSSCP00000010407 XP_020927875.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]