SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010436 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010436
Domain Number 1 Region: 295-359
Classification Level Classification E-value
Superfamily RILP dimerisation region 4.97e-20
Family RILP dimerisation region 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010436   Gene: ENSSSCG00000009773   Transcript: ENSSSCT00000010715
Sequence length 403
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:31116986:31162616:1 gene:ENSSSCG00000009773 transcript:ENSSSCT00000010715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEDRGSALAAESALEKNVAELTVMDVYDIASLVGHEFERVIDQHGCEAIARLMPKVVRV
LEILEVLVSRHHVAPELDELRLELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLL
SQIAQLQEENKQLMTNLSHKDVSFSEEEFQKHEGMSERERQVMKKLKEVVDKQRDEIRAK
DRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEM
GSLRAELGKLRERLQGELSQNGDEEPEMEPGGEECVSEAEKVAMDLKDPNRPRFTLQELR
DVLHERNELKSKVFLLQEELAYYKSEEIEEENRIPQPPPVAHPRMSPQPESGIKRLFSFF
SRDKKRLANTQRNVHIHESFGQWANSHRDDGYTEQGQEALQHL
Download sequence
Identical sequences A0A287A6M5
ENSSSCP00000010436 XP_001925390.4.46622 ENSSSCP00000010436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]