SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010441 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010441
Domain Number 1 Region: 127-198
Classification Level Classification E-value
Superfamily RILP dimerisation region 3.53e-18
Family RILP dimerisation region 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010441   Gene: ENSSSCG00000009778   Transcript: ENSSSCT00000010720
Sequence length 204
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:31187805:31211475:1 gene:ENSSSCG00000009778 transcript:ENSSSCT00000010720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPPLREEEEEGDEAGPEGALGKSPFQLTAEDVYDISYVMGRELMALGSDPRVTQLQFK
IVRVLEMLETLVNEGNLTVEELRMERDNLRTEVEGLRREGSAAGGEVNLGPDKMVVDLTD
PNRPRFTLQELRDVLQERNKLKSQLLVAQEELQCYKSGLIPPREGPGGRREKDTLVARAN
NARSNKEEKTIIRKLFSFGSGKQT
Download sequence
Identical sequences F1RFJ9
XP_013838240.1.46622 ENSSSCP00000010441 9823.ENSSSCP00000010441 ENSSSCP00000010441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]