SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010467 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010467
Domain Number 1 Region: 11-368
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 9.42e-81
Family Extradiol dioxygenases 0.0000000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010467   Gene: ENSSSCG00000009805   Transcript: ENSSSCT00000010747
Sequence length 393
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:32650787:32662905:1 gene:ENSSSCG00000009805 transcript:ENSSSCT00000010747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSYSDKGEKPERGRFLHFHSVTFWVGNAKQAASYYCSKIGFEPLAYKGLETGSREVVSH
VVKQDKIVFVFSSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDYIVQKARERGAIIVRG
EVCCAADGEGSPTPLQRCRELWSHTLVEKAAFCLDSRPQPSQTLPQFLHLSNGPKCGLEI
IDHIVGNQPDQEMESASQWYMRNLQFHRFWSVDDTQIHTEYSALRSVVMANYEESIKMPI
NEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRSLRERGVEFLAVPFTYYKQLQ
EKLKSAKIRVKESIDVLEELKILVDYDEKGYLLQIFTKPMQDRPTVFLEVIQRNNHQGFG
AGNFNSLFKAFEEEQELRGNLTDTDPNGVAFRL
Download sequence
Identical sequences A0A286ZK24
ENSSSCP00000010467 ENSSSCP00000010467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]