SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010480 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000010480
Domain Number - Region: 129-171
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0603
Family Papain-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010480   Gene: ENSSSCG00000009817   Transcript: ENSSSCT00000010760
Sequence length 595
Comment pep:novel chromosome:Sscrofa10.2:14:33279227:33340436:-1 gene:ENSSSCG00000009817 transcript:ENSSSCT00000010760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAWCSWNDVFQYETNKVTRIQSMNYGTIKWFFHVLVFSYVSFALVSDKRYQRKESVISS
VHTKVKGIAEVTQEIVENGLKKVVPSVLDTADYTFPLQGNSFFVMTNFLKTEGQEQGLCP
EYPTRRTLCSSNQGCKKGWMDPQSKGIQTGRCVEYKGKQKTCEVSAWCPIEAVEEAPQPA
LLRSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPLCPIFRLGDIFRETGD
NFSDVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDDKTAKESSYPGYNFRYAKYYK
ENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLIVYIGSTLSYFGLATVFIDFLINTYSN
NCCRSHVYPCCKCCEPCAVNEYYYRKKCESIMEPKPTLKYVSFVDEPHIRMVDQRLLGRS
LQDVKGEEVPRPPMDFTDLSRLPLSLHDPPFIPGQPEAIQLLSEEAAPKSSDCPDWCQCG
NCLPSQLPDSHKCLEELCCRKKLGACITTSELFQKLVLSRGVLQFLLHYQEPLLVLDADS
ANSQLRHCAYRCYTIWRFGSQDLADFAILPSCCRWKIRREFPKSEGQYSGFQSPY
Download sequence
Identical sequences F1RNN5
ENSSSCP00000010480 ENSSSCP00000010480 XP_001926839.2.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]