SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010556 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010556
Domain Number 1 Region: 34-516
Classification Level Classification E-value
Superfamily ALDH-like 8.51e-184
Family ALDH-like 0.0000000000000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010556   Gene: ENSSSCG00000009889   Transcript: ENSSSCT00000010839
Sequence length 521
Comment pep:known chromosome:Sscrofa10.2:14:42378891:42409687:-1 gene:ENSSSCG00000009889 transcript:ENSSSCT00000010839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRPAALAAARLVLRQGRRLLSAAPTQAVPAPNQQPEIFYNQIFINNEWHDAISKKTFPT
VNPSTGDVICHVAEGDKEDVDRAVEAARAAFQLGSPWRRLDASDRGRLLNRLADLIERDR
TYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTLPIDGDYFSYTRHEPV
GVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVSEQTPLTALYVANLIKEAGFPPGVVN
IVPGYGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGKSNLKRVTLELGGKSPNIIMS
DADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYAEFVERSVARARSRVVGNPFDSRT
EQGPQIDETQFKKILGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEE
IFGPVMQILKFKTIEEVIGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVF
GAQSPFGGYKLSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Download sequence
Identical sequences Q2XQV4
ENSSSCP00000010556 NP_001038076.1.46622 9823.ENSSSCP00000010556 ENSSSCP00000010556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]