SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010643 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010643
Domain Number 1 Region: 32-128
Classification Level Classification E-value
Superfamily Kringle-like 4.11e-28
Family Kringle modules 0.00082
Further Details:      
 
Domain Number 2 Region: 216-323
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-25
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010643   Gene: ENSSSCG00000009972   Transcript: ENSSSCT00000010928
Sequence length 484
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:49218205:49284491:1 gene:ENSSSCG00000009972 transcript:ENSSSCT00000010928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPAARLALLSAAALTLAARPAPSPGLGPGPECFTANGADYRGTQNWTAPQDGKPCLFW
NETFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPG
NLGCYKDHGNPPPLTGASKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKY
GEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMTSVVYSPDFPDTYATGR
VCYWTIRVPGASHIHFNFTLFDIRDSADMVELLDGYTHRVLVRFNGRNRPPLSFNVSLDF
VILYFFSDRINQAQGFAVLYQAFPQCIPFDLPAVKEEPPQERPTANQTVAEVITEQANFS
VSAAWSSKVLYVITTSPSHPPQAVPGSSSQTPSKGRSHRAGWTVYGLATLLILTVTAIIA
KILLHLTSKSHSVPASGDLRDCHQPGTSGEIWSIFYKPSTSISIFKKKLKGQSQQDDRNL
LVSD
Download sequence
Identical sequences ENSSSCP00000010643 ENSSSCP00000010643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]