SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010683 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010683
Domain Number 1 Region: 233-326
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000196
Family Multidrug resistance efflux transporter EmrE 0.011
Further Details:      
 
Domain Number 2 Region: 87-180
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000432
Family Multidrug resistance efflux transporter EmrE 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010683   Gene: ENSSSCG00000010012   Transcript: ENSSSCT00000010969
Sequence length 351
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:50631252:50637308:1 gene:ENSSSCG00000010012 transcript:ENSSSCT00000010969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRCPPEHHDSRMTSAEVVALAGGARLAGSPEWPPDTPQALGRPGRARVAVAALVWLLAG
ASMSSLNKWIFTVHGFGRPLLLSALHMLAAALACHRGAQRPMPGRTRRQVLLLSLTFGTS
MACGNVGLNAVPLDLAQLATTTTPLITLALSGLLLGRRHHPLQFAAMGPLCLGAACSLAG
ELRTPPAGCGFLLVATCLRGLKSVQQTGALLQEERLDAVTLLYATSLPSFCLLVGAALVL
EAGVAPPPAPTDSRLWACILLSCLLSVLYNLASFSLLALTSALTVHVLGNLTVVGNLILS
RLLFGSRLSTLSYVGIALTLSGMFLYHNCEFVASWAARRGFWRRDQPGKGL
Download sequence
Identical sequences ENSSSCP00000010683 ENSSSCP00000010683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]