SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010697 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010697
Domain Number 1 Region: 6-111
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-19
Family Kringle modules 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010697   Gene: ENSSSCG00000010026   Transcript: ENSSSCT00000010983
Sequence length 263
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:51151822:51162385:-1 gene:ENSSSCG00000010026 transcript:ENSSSCT00000010983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLACVQTILVSNMLLAEAYGSGGCFWDNGHLYQADQLSPSPGLHCLNWLDAQSGLASDP
ESGPGNHSYCRNPDQDPRGPWCYVSGEAGAPEKRLCEDLRCPETNSQGLPTFTTETEEAS
EVPGGEEVQVFAPANALPARSEVAAVQPVIGISQRVRVNSKEKKDLGTLGSVLGITMMVI
IIAIGAGIVLGYTYKRGKDLKEQHKQKACEREMQRITLPLSAFTNPTCEIVDEKTVVVHT
SQTPVDLQEGSAPLMGQAGTPGA
Download sequence
Identical sequences F1RPC1
XP_001926569.1.46622 ENSSSCP00000010697 9823.ENSSSCP00000010697 ENSSSCP00000010697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]