SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010782 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010782
Domain Number 1 Region: 245-382
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000177
Family Growth factor receptor domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010782   Gene: ENSSSCG00000010109   Transcript: ENSSSCT00000011070
Sequence length 870
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:54455011:54465672:1 gene:ENSSSCG00000010109 transcript:ENSSSCT00000011070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGAGPRGAGPARRRGAGGPPPRLLPPPPLLLLLWLLPGPAAPQELSPRGRNVCRAPGSQ
ELTCCIGWRQQGDECGIAVCEGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQFWGP
DCKELCVCHPHGQCEDVTGQCTCHARRWGARCEHACQCQHGACHPRSGACRCEPGWWGAQ
CASACYCSATSRCDPQTGACLCHSGWWGRSCNNQCACNSSPCEQQSGRCQCRERTFGARC
ERYCQCFRGRCHPVDGTCSCEPGYRGKYCREPCPAGFYGPGLPPPCGQCKGQQPCTVAEG
RCLTCEPGWNGTKCDQPCSTGFYGEGCGHRCPPCRDGHSCNHVTGKCTRCNAGWIGDRCE
TKCSNGTYGEDCAFVCADCGSGHCDFQSGRCLCSPGVHGPHCNLTCPPGLHGVDCAQACS
CHEDSCDPVTGACRLETNQRKGVMGAGALLALLLGLLLSLLGCCCACRGKDPARGELTFG
RKKAPQRLCGRFSRISMKLPRIPLRRQKLPKVVVAHHDLDNTLNCSFLEPPSGLEQPSPS
WSSRASFSSFDTTDEGPVYCVPHEEAATESRDAEAPTAPASAETLAQSPAPVATPAPAEE
ATPLPASSDSERSASSGDGPGGALYARVARREARPARVRGEARGLSLSPSPERRKPPPPD
PATKPKVSWIHGKHGAAAAARAPSPLPAGPEAAPSPSKRKRTPSDTSARPEEPGSPRARD
PTPRHPGLAEEGPALASPSPPRARARGRGPGLPEPTDAGGPPRSAPEAASMLAAELRDKT
RSLGRAEGALGTQVPREKPAPPQKAKRSVPPASPARAPPAPEAPGPEKAAAGAPGTDTPR
KKTPIQKPPRKKSRRCGALSSPAGAQPGAP
Download sequence
Identical sequences 9823.ENSSSCP00000010782 ENSSSCP00000010782 ENSSSCP00000010782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]