SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010815 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010815
Domain Number 1 Region: 665-778
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.6e-18
Family SPRY domain 0.026
Further Details:      
 
Domain Number 2 Region: 3582-3660
Classification Level Classification E-value
Superfamily EF-hand 0.000000000699
Family Calmodulin-like 0.051
Further Details:      
 
Domain Number 3 Region: 243-391
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000594
Family SPRY domain 0.052
Further Details:      
 
Domain Number 4 Region: 8-132
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000034
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 5 Region: 1732-1802
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000445
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000010815
Domain Number - Region: 996-1117
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000475
Family SPRY domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010815   Gene: ENSSSCG00000010142   Transcript: ENSSSCT00000011103
Sequence length 4542
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:57572533:57938291:-1 gene:ENSSSCG00000010142 transcript:ENSSSCT00000011103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRGLDALSKKAKASTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLF
QEEGMINLVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAALIRGNRKNCA
QFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRNHK
VLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQ
YKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDG
LHLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGLFF
PVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREYKQERTYTRD
LLGPTVSLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIELGWQYGPVRD
DNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEEKVKKMKLPKN
YQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRN
PRLVPYALLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCSGTGERFRIFR
AEKTYAVKAGRWYFEFEAVTAGDMRVGWSRPGCQPDQELGSDERAFAFDGFKAQRWHQGN
EHYGRSWQAGDVVGCMVDMTEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVCSLGV
AQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQVPSSHEHIE
VTRIDGTIDSSPCLKVTQKSFGSQNSSTDIMFYRLSMPIECAEVFSKTSAGGIPGASLFG
PKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEATKPEFNNHKDYAQEKPSRLKQRFL
LRRTKPDYSTSHSARLTEDVLADDRDDYDYLMQTSTYYYSVRIFPGQEPANVWVGWITSD
FHQYDTAFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGRNNNGLEIGC
VVDAASGLLTFTANGKDLSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAG
LFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCLEPLQFMS
LHIPEENRSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAI
ENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETKSITLFPDENKKHGLP
GIGLSTSLRPRMQFSSPSFVSINNECYQYSPEFPLDILKAKTIQMLTEAVQEGSLHARDP
VGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAAGPEEESDTLEKEPC
ASEDSRLEGPAEEESKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAF
SDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFKDDKSECPC
PEEIRDQLLDFHEDLMTHCGIELDEDGSLDGNSDLTIRGRLLSLVEKVTYLKKKQAEKLV
ESDSKKSSTLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTI
NGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMH
ETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVG
LGTASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYP
DIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAA
MEEAIKIAEDPSRDGPSPTSGSSKMPDTEGEEDDTIHMGNAIMTFYAALIDLLGRCAPEM
HLIHAAKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGNVVEPDMSAGFCPDHKA
AMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLP
LLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQ
HLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFW
GIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNFNPQPV
DTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEK
EKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSVDAAHGYSPRAI
DMSNVTLSRDLHAMAEMMAENYHNIWAKKKKLELESKGGGNHPLLVPYDTLTAKEKAKDR
EKAQDILKFLQINGYAVSRGFKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYILEFDGG
SRSKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKEKEMVTS
LFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLESVKSALRAFLDNAAE
DLEKTMENLKQGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDV
QVSCYRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPVAFLETHLDKHNIYSIYNT
KSSRERAALNLPTNVEDVCPNIPLEKLMEEIVDLAESGIRYTQMPHVMEVVLPMLCSYMS
RWWEHGPENNPGRAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPII
NKVKPQLLKTHFLPLMEKLKKKAAMVVSEEDHLKSEVRGDMSEAELLILDEFTTLARDLY
AFYPLLIRFVDYNRAKWLKEPNPEAEDLFRMVAEVFIYWSKSHNFKREEQNFVVQNEINN
MSFLITDTKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQE
LIALAKNRFSLKDTEDEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNRTEDTSDPEKT
VERVLDIANVLFHLEQKSTCMRRRYYSLVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAP
LYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAVPPEEDEGTKRVDPLHQL
ILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEEKEMEKQKLLYQ
QARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLEYLKEKKDV
GFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQLLC
EGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFS
KAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIEL
LKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLT
SSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRF
HEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIER
VYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQIS
ESDLNERSANKEESEKEKPEEQGPRMGFFSLVTVRSALLALRYNVLTLMRMLSLKSLKKQ
MKKVKKMTVRDMVTAFFTSYWSVFMTLLHFAASVSRGFSRIIGGLLLGGSLVEGAKKIKV
AELLANMPDPTQDEVRGDGDEGERKVLEGTLPSEDLTDLKELTEESDLLSDIFGLDLKRE
GGQYKLIPHNPNAGLSDLMSSPAPIPEVQEKFQEQKAKEEEKEEKEENKSEPEKAEGEDG
EKEEKAKEDKGKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLLQNYFARNFYNMRML
ALFVAFAINFILLFYKVSTSSVVEGKELPTRSSSENANFGSLDSSSPRIIAVHYVLEESS
GYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDD
IKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREK
KKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLD
IAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMK
CDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGL
IIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYL
INKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences ENSSSCP00000010815 ENSSSCP00000010815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]