SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010859 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010859
Domain Number 1 Region: 19-346
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.05e-128
Family Calpain large subunit, catalytic domain (domain II) 0.0000000000429
Further Details:      
 
Domain Number 2 Region: 349-492
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 4.58e-53
Family Calpain large subunit, middle domain (domain III) 0.00000259
Further Details:      
 
Domain Number 3 Region: 509-687
Classification Level Classification E-value
Superfamily EF-hand 5.44e-44
Family Penta-EF-hand proteins 0.0000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010859   Gene: ENSSSCG00000010182   Transcript: ENSSSCT00000011148
Sequence length 690
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:64247757:64288574:-1 gene:ENSSSCG00000010182 transcript:ENSSSCT00000011148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHLYRAPGPQEPPTPKDARITHSSGQSFEELRQACLQKGVLFEDTDFPADSSSLFYSER
PQIPFVWKRPGEIVKNPEFILGGATRTDICQGELGDCWLLAAIASLTLNEKALARVVPHN
QSFGPGYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKL
NGSYEALKGGSAIEAMEDFTGGVAETFTTKEAPWNFYEILEKALTRGSLVGCSIDIRNAA
ESEARTPFGLIKGHAYTVTGVDQVNIRGQKVELIRVRNPWGQVEWTGSWSDSSSEWRSVG
PAEQKRLCHTALDDGEFWMAFRDFRAHFDKVEVCNLTPDALEEDAVHKWEVTVHQGSWVR
GSTAGGCRNFLDTFWTNPQIKLSLTEKDEGQEECTFLVALMQKDRRKLKRFGANVLTIGY
AIYQCPGQEGHLNKDFFRYHASQARSKTFINLREVSDRFRLPPGDYILIPSTFEPHQEAD
FCLRIFSEKKAITRDMDGSVDIDLPEPPKPTAPGQETEEERQFQALFKQVAGEDMEVTAE
ELKYVLNAVLQKKKDIKFKELSLISCKNIISLMDTSGNGKLEFSEFKVFWDKLKKWMSLF
LQFDADKSGTMSSYELRSALKAAGFQLSSPLLQLIVLRYADPELQLGFDDFLNCLVRLEN
ASRMFQALSTKNKEFIHLNINEFIVLTMNI
Download sequence
Identical sequences ENSSSCP00000010859 ENSSSCP00000010859 9823.ENSSSCP00000010859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]