SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010937 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010937
Domain Number 1 Region: 350-535
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.18e-30
Family Prokaryotic proteases 0.0032
Further Details:      
 
Domain Number 2 Region: 26-54,183-289
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000000242
Family Prokaryotic proteases 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010937   Gene: ENSSSCG00000010259   Transcript: ENSSSCT00000011229
Sequence length 568
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:78996429:79008539:-1 gene:ENSSSCG00000010259 transcript:ENSSSCT00000011229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRQWGPAMRAAEQAGCMVSASRAGQPKAGLWSCSGVILSRRPGLVLCHGGIFTHFLRAG
SGALTVAGAAFLPGDSCSDDLRLHVQWGPTAASPAGRAERGRAGLCTPQCAGLDPGPPAR
PRGRQLQPPRPAELLLLLSCPIFRGQFARLFGSETAEQWHFASAAPEDEVSEEEEEDQLR
ALGWFALLRVLPDPEREAEAVERGPIVAVAPLGAVPKGAPLLACGSPFGAFCPDIFLNTL
SRGVLSNSAGPLLLTDARCLPGTEGGGVFAARPAGTLVALVAAPLCWKAREWVGLTLLCA
AAPLLCAARDALCHLHPGTDALAAFLPQEMGAPWDRPLRDPGPPWAAAAVLVECGSVWGS
GVAVAPRLVVTCRHVAPREAAGVLVRSTTPKGAIIWGHVVFATQETSPYDIAVVSLEEDL
EGVPIPVPAEDFHEGEAVTVVGFGVFGQACGPSVTSGILSAVVQVDDTPVMLQTTCAVHG
GSSGGPLFSTCSGNLLGIIASNTRDNNTGATYPHLNFSIPITVLQPALQRYHQTGDLGGL
RQLDRATEPVRVVWRLQQPQTEAPRSKL
Download sequence
Identical sequences ENSSSCP00000010937 ENSSSCP00000010937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]