SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010951 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010951
Domain Number 1 Region: 261-460
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.34e-47
Family Reprolysin-like 0.0019
Further Details:      
 
Domain Number 2 Region: 554-604
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000017
Family TSP-1 type 1 repeat 0.00045
Further Details:      
 
Domain Number 3 Region: 912-970
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000301
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 4 Region: 973-1024
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000262
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 850-908
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000772
Family TSP-1 type 1 repeat 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010951   Gene: ENSSSCG00000010272   Transcript: ENSSSCT00000011243
Sequence length 1225
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:79413375:79501706:1 gene:ENSSSCG00000010272 transcript:ENSSSCT00000011243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLCALLSCLLLLHCALCAAAAGSRTPELRLSRKLSDYGMTVPCSTDFRGRFLSHVVSG
PAAASAGSTEADRPPAPLSHSGHLRVARSPLRPKGVTLQPGRVGRSSLYFNVTVFGEELH
LHLRPNRRLVVPGASVEWQEDFRELFRQPLRRECVYTGGVTGMPGAAVAISNCDGLAGLI
RTDSTDYFIEPLEWGQQEMEASGRTHVVYRRDVIQPAWTEPLGDLHNEAFGLGDLSNLLG
LVGDRLGEAERKRRHAKTGSYSIEVLLAVDDSVVRFHGREHVQNYVLTLMNIVNEIYHDE
SLGVHINIALVRLIMVGYRQSLNLIERGNPSRSLEQVCRWAHSQQRQDPGHAEHHDHVIF
LTRQDFGPSGYAPVTGMCHPLRSCALNHEDGFSSAFVVAHETGHVLGMEHDGQGNGCADE
TSLGSVMAPLVQAAFHRFHWSRCSKLELSRYLPSYDCLLDDPFAPAWPQPPELPGIDYSM
DEQCRFDFGTGYHTCSALRTFEACKQLWCSHPDNPYFCKTKKGPPLDGTECAPGKWCFKG
HCIWKSPEQMYGQDGGWSSWTHFGSCSRSCGGGVRSRSRSCDNPPPAYGGRLCSGPTFQY
QVCNSEECPGPYEDFRAQQCAKRNSYYVHQNAKHSWVPFEPDDDAQKCELICQSEDTGDV
VFMNQVVHDGTRCSYRDPYSVCARGECVPVGCDKEVGSMKTDDKCGVCGGDNSHCRTVKG
TLGKASKQAGALKLVQIPAGARHIQIEELEKVPHHIAVKNQVTGSFILNPKGKEATSRTF
TAMGLEWEYAVEDAKESLKTSGPLPEAIAVLVFPPAEGGPRSSLAYKYIIHEDLLPLIGS
NNVLLEETDTYEWALKSWAPCTKACGGGIQFTKYGCRRRRDHHMVQRHLCDHRKRPKPIR
RRCNQHPCAQPVWVTEEWGTCSRSCGKLGVQTRGVQCLLPLSNGTHKAMPAKACPGDRPE
ARRPCFRVPCPVQWRTGAWSQQCSVTCGEGIQQRQVVCRTSANSLGQCEGDKPDTVQVCS
LPACEGQLQNSTVRADDPELVTPEEQWVPPSEPLDPINRISSTEPCVGDRSIFCQPELLH
RYCSVPSYPRLCCESCTKTASDPDASPPGLVSPPPFSTPGSPFPGPKAPPDAAEPTLGPT
ESDEHQRGRPTQLPGPLSTSSPVTQRSFALQKLSPTVFGGTSPSTPQELSWGWTGAPTPA
SENKGQLREDPKHPGTSLPATTPVT
Download sequence
Identical sequences ENSSSCP00000010951 ENSSSCP00000010951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]