SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010983 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010983
Domain Number 1 Region: 9-324
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.35e-24
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.021
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000010983
Domain Number - Region: 755-834
Classification Level Classification E-value
Superfamily MIT domain 0.000122
Family MIT domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010983   Gene: ENSSSCG00000010302   Transcript: ENSSSCT00000011275
Sequence length 1647
Comment pep:known chromosome:Sscrofa10.2:14:82433503:82495889:-1 gene:ENSSSCG00000010302 transcript:ENSSSCT00000011275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLNLKLNVVLWHLDIFRRSFRQLTTHKCMGDSCIFCALKGIFNQFQCSSEKVLPSDALRS
ALAKTFQDEQRFQLGIMDDAAECFENLLMRIHFHIADETKEDICTAQHCISHQKFAMTLF
EQCVCTSCGATSDPLPFIQMVHYISTTSLCNQAICMLERREKPSPSMFGELLQNASTMGD
LRNCPSNCGERIRIRRVLMNAPQIITIGLVWDSDHSDLAEDVIHSLGTCLKLGDLFFRVT
DDRAKQSELYLVGMICYYGKHYSTFFFQTKIRKWMYFDDAHVKEIGPKWKDVVTKCIKGH
YQPLLLLYADPQGTPVSTQDLPPQVEFQSYSRTCYDSEDSGREPSISSDTRTDSSTESYP
YKHSHHESVISHFSSDSQGTVIYNVENDSTSQSSRDTGHLTDSECNQKLPSKKGSLIERK
RSSGRVRRKGDEPQASGYHSEGETLKEKQAPRNASKSSSGTNRLRDFKETVSNMIHNRPS
LTSQTNLGTPCGGRGGDQTDKKPPRNLPLHSLDWEVESTSSESKSSSSSKYRPTWRPKRE
SLNIDSIFSKDKRKHCGYTQLSPFSEDSAKEFSPDELSKPPAYDIKTGGPSSQYKIWGPA
RPGCHLLEQHPRLIQRMESGYESSERNSSSPVSLDAALPESSNVCRDPNAKRSAGLVPSW
RHIPKSHSSSILEADSIASRSGWTKNQPPSGGEMPSKSELDELQEEVARRAQEQELRRKR
EKELEAAKGFNPHPSRFMDLDELQNQGRNDGFERSLQEANSVFEESLHLEQKGDCAAALA
LCNEAISKLRLALHGASSSTHSRALVDKKLQISIRKARSLQDRMQQQQSSQPPSQPSACL
PSQGGALPQPTSEQPIPLQVLLSQEAQLEPYTNTEFGTSSFTYSPASCHESHLPLFPESS
SLSAPQHISPSGSASNLLTSVEVDSIEPSVFHRQNLPKTPGRTENSQHGWEPEGELQSCS
GDNSSCTRFPPQEGRGVDPEQLFQEQRDAADSSQVMPWLHPSGATTSERGDAHSLGCSPS
SSSAQPSLSLYRACHPVTSAASSSMLHSPNTVQKTNQCLQTQSLKTSLTSEVDRGSKDPY
RPECPTTKGLVRSLAEQFQRMQGSSTRDGTGSQDRSLPDSLRKDSSPSDSKPSFPQGQGK
GHWPWAKQQPSVDARNRLPSWEESNDHLSLAMNSGVPKGKTSRGEQPRLAEPGIYHGKPS
QVRDARPKELGSSDDLGTSLPLDSWVNVTRLCDSQPKHGVPGPGMKFSSHDSHTCVTYPE
RNHILLHPHWNQDTEQETSELESLYQASLQVSQSGYPGWGQQDVAWHPLSQTGSTDGVGR
RLHSAPGLGLSKTPTAEMEHSLHEASTVSASQAAPCRGPRRECGEDDQYGAENFRRISRS
LSSTIVSERVEVPLSSHSFDSSNSRKKPLETGHRCSSSSSLPVIHDPPVFLLRPQLYPPQ
PQFLSPDVLMPSVAGEPHRPPGTSRSVQQLLAMCDRSETSEGVKYTGRTLNYRSLPHHSK
TAASCGSWSETNQHTGARFLTTPGCKPQLTHTATLPERHQDLQVPHAQSWGDLFHSPSHF
PIVDPVSPASSSLHVPLRSAWNSGPVSGFRAPGPRRVDMPPDDDWRQNSYALQSGHRRTG
REEFLFVVADSPGREQIRARALQHSRW
Download sequence
Identical sequences ENSSSCP00000010983 ENSSSCP00000010983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]