SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010995 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010995
Domain Number 1 Region: 177-434
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.99e-78
Family Eukaryotic proteases 0.0000000051
Further Details:      
 
Domain Number 2 Region: 51-161
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-33
Family Kringle modules 0.0000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010995   Gene: ENSSSCG00000010312   Transcript: ENSSSCT00000011287
Sequence length 442
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:82755602:82761495:1 gene:ENSSSCG00000010312 transcript:ENSSSCT00000011287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLRACLLLCVLVVSDSKGSHELHQESGASNCGCLNGGKCVSYKYFSNIQRCSCPKKFQ
GEHCEIDTSQTCFEGNGHSYRGKANTNTGGRPCLPWNSATVLLNTYHAHRPDALQLGLGK
HNYCRNPDNQRRPWCYVQVGLKQLVQECMVPNCSGGESHRPAYDGKNPFSTPEKVEFQCG
QKALRPRFKIVGGKSTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVVSATHCFINY
QQKEDYIVYLGRQTLHSSTRGEMEFEVEKLILHEDYSADSLAHHNDIALLKIRTDKGQCA
QPSRSIQTICLPPVNGDAHFGASCEIVGFGKEDPSDYLYPEQLKMTVVKLVSHRECQQPH
YYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSTQGRLTLTGIVSWGRECAMKDKPGVY
TRVSHFLTWIHTHVGGENGLAH
Download sequence
Identical sequences F1SU38
ENSSSCP00000010995 9823.ENSSSCP00000010995 ENSSSCP00000010995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]