SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011040 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011040
Domain Number 1 Region: 31-184
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.1e-21
Family Phosphate binding protein-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011040   Gene: ENSSSCG00000010352   Transcript: ENSSSCT00000011333
Sequence length 382
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:93397981:93510567:-1 gene:ENSSSCG00000010352 transcript:ENSSSCT00000011333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDLSKQVEMSYGTVRDSAV
YEYFRAKGTNPLEQDSTFSELWRTISKNGGADNCVSSPSEGIRKAKKGNYAFLWDVAVVE
YAALTDDDCSVTVIGNSVSSKGYGIALQHGSPYRDLFSQRILELQDTGDLDVLKQKWWPH
TGRCDLTSHASAQADGKALKLHSFAGVFCILAIGLLLACLVAALELWWNSNRCHQETPKE
DKEVNLEQVHRRMNSLMDEDIAHKQISPASIELSALEMGGLAPSQALEPTREYQNTQLSV
STFLPEQSSHGTSRTLSSGPSSNLPLPLSSSATMPSMQCKHRSPNGGLFRQSPVKTPIPM
SFQPVPGGVLPEALDTSHGTSI
Download sequence
Identical sequences ENSSSCP00000011040 ENSSSCP00000011040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]