SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011218 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011218
Domain Number 1 Region: 50-160
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.19e-38
Family Frizzled cysteine-rich domain 0.0000587
Further Details:      
 
Domain Number 2 Region: 177-305
Classification Level Classification E-value
Superfamily TIMP-like 1.24e-22
Family Tissue inhibitor of metalloproteinases, TIMP 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011218   Gene: ENSSSCG00000010529   Transcript: ENSSSCT00000011519
Sequence length 315
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:118623934:118629819:-1 gene:ENSSSCG00000010529 transcript:ENSSSCT00000011519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAAARGARAAALALLLGALHGAPAHGEEYDYYGWQTEPLHGRSYSKPPQCLDIPADLPL
CHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIY
PCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKICA
QCEMEHSADGLMEQMCSSDFVVKMRLKEIKIESGDRKLIGAQKKKKLLKPGPLKRKDTKR
LVLHMKNGAGCPCPQLDSLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFSYP
CSLYYPFFYGAVEPH
Download sequence
Identical sequences ENSSSCP00000011218 9823.ENSSSCP00000011218 ENSSSCP00000011218 NP_001230335.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]