SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011334 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011334
Domain Number 1 Region: 289-548
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.4e-77
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 171-277
Classification Level Classification E-value
Superfamily Kringle-like 9.18e-33
Family Kringle modules 0.00022
Further Details:      
 
Domain Number 3 Region: 72-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000288
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 110-147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000152
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011334   Gene: ENSSSCG00000010639   Transcript: ENSSSCT00000011636
Sequence length 552
Comment pep:known chromosome:Sscrofa10.2:14:135129974:135165466:-1 gene:ENSSSCG00000010639 transcript:ENSSSCT00000011636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFARKSELHVLLFMVLAAKTAFGFSLLSLLTDLDPDWTPENYEYSYENYNQEENSSAPAH
HENPDWYYTEDDPCLSNPCAHGGDCLVSGDTFTCSCPAPYSGNRCQKVQNKCKNKPCGRG
ECLITQSPPYYRCACKHPYRGPDCSTVVPVCRPNPCQNGGTCSRHRRRSKFTCTCPDQFK
GRFCEIGSDDCYVGDGYSYRGEVSKTVNQHTCLYWNSHLLLQENYNMFMEDAEAHGIGEH
NFCRNPDGDRKPWCFIKVSSAKVKWEYCDVPACSAPEGSPIEPVTELPGFDSCGRTETAE
RKFKRIYGGFKSTAGKHPWQASLQTSLHLTVSMPQGHFCGGALIHPCWVLTAAHCTDIKA
KYLKVVLGDQDLKKTELHEQSFGVEKIFKHSRYREKDDIPYNDIALLKLKPVDGHCALES
KYVKTVCLPDSPFPSGTECYISGWGVTETGEGSRQLLDAKVKLISNAVCNSRRLYDHMLD
DNMICAGNLQKPGQDSCQGDSGGPLTCEKDDAYYVYGIVSWGLECGKKPGVYTQVTTFLN
WIRATMEREASF
Download sequence
Identical sequences A0A287AZ81
NP_001230619.1.46622 XP_020927688.1.46622 ENSSSCP00000011334 ENSSSCP00000011334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]