SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011391 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011391
Domain Number 1 Region: 114-182,488-626,681-831
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.06e-33
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 
Domain Number 2 Region: 32-211,300-316,348-387
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.93e-18
Family WD40-repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011391   Gene: ENSSSCG00000010692   Transcript: ENSSSCT00000011693
Sequence length 1229
Comment pep:known chromosome:Sscrofa10.2:14:142235175:142290136:1 gene:ENSSSCG00000010692 transcript:ENSSSCT00000011693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPYTVNFKVSARTLTGALNAHNKAAVDWGWQGLIAYGCHSLVVVIDSNTAQTLQVLEKH
KADVVKVKWASENYHHNIGSPYSLRLASADVNGKIIVWDVAAGIAQCEIQEHAKPIQDVQ
WLWNQDASRDLLLAIHPPNYIVLWNADTGTKLWKKSYADNILSFSFDPFDPSHLTLLTSE
GIVFISDFSPSKPPSGPGKKVYISSPHSSPAHSKVAAATGAKKALNKVKILITQEKPSAE
FITLNDCLQLAYLPSKRNHMLLLYPREILILDLEVNQTVGVIAIERTGVPFLQVIPCFQR
DCLFCLHENGCITLRVRRSYNSIFTTSSEEPDPDPVQELTYDLRSQCDAIRVTKTVRPFS
MVCCPVNENAAALIVSDGRVMIWELKSAVCSRNSRNSSSGVSPLYSPVSFCGIPVGVLQN
KLPDLSLDNMIGQSAVAGEEHPKSPILQEVHLKFLLTGLLSGLPSPHFAIRMCPPLTTKN
IKVYQPLLAVGTSNGSVLVYHLTSGLLHKELSIHSCEVKGIEWTSLTGFLSFATSTPNNM
GLVRNELQLVDLPTVFATTGRSIAFRGERGNDESPIEMIKVSHLKQYLAVVFKDKPLELW
DVRTCTILREMSKNFPAITALEWSPSHNLKSLRKKQLATREAMARQTVVSDTELSVVESS
VISLLQEAESKSELSQNISAREHFVFTDNDGQVYHLTVEGNSVKDSARIPPDGSMGSITC
IAWKGDTLVLGDMDGNLNFWDLKGRVSRGIPTHRSWVRKIRFAPGKGNQKLIAMYNDGAE
VWDTKEVQMVSSLRSGRNVTFRILDVDWCTSDKVILASDDGCIRVLEMSMKSTCFRMDEQ
ELTEPVWCPYLLVPRASLALKAFLLHQPWNGRYSLDVSHIDYPENEEIKNLLQEQLNSLS
NDIKKLLLDPEFTLLQRCLLVSRLYGDESELHFWTVAAHYLHSLSQERAASTTAARAPAP
RDRVNNPLDICYDILCENAYFQKFQLERVNLQEVKRSTYDHTRKCTDQLLLLGQTDRAVQ
LLLETSAENQHYYCDSLKACLVTTVTSSGPSQSTIKLVATNMIANGKLAEGVQLLCLIDK
AADACRYLQTYGEWNRAAWLAKVRLNSEECADVLKRWVDHLCSPQVNQKSKALLVLLSLG
CFSSVAETLHSMRYFDRAALFVEACLKYGAIEVSQDTDKLIAAIYADYARSLKNLGFKQG
AVLFASKAGAAGRDLLNELESPKQELTAQ
Download sequence
Identical sequences ENSSSCP00000011391 ENSSSCP00000011391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]