SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011515 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011515
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.7e-63
Family Ubiquitin carboxyl-terminal hydrolase UCH-L 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011515   Gene: ENSSSCG00000010802   Transcript: ENSSSCT00000011818
Sequence length 313
Comment pep:known chromosome:Sscrofa10.2:10:2342748:2413848:1 gene:ENSSSCG00000010802 transcript:ENSSSCT00000011818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFSEIISCFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDT
IFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVI
RQVHNSFARQQMFEFDAKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDW
ISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGSNM
LSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKA
KEKQNAKKAQETK
Download sequence
Identical sequences ENSSSCP00000011515 ENSSSCP00000011515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]