SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011518 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011518
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.23e-48
Family Ubiquitin carboxyl-terminal hydrolase UCH-L 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011518   Gene: ENSSSCG00000010805   Transcript: ENSSSCT00000011821
Sequence length 252
Comment pep:novel chromosome:Sscrofa10.2:10:2258881:2274919:1 gene:ENSSSCG00000010805 transcript:ENSSSCT00000011821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FYILQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIR
QVHNSFARQQMFEFDAKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWI
SAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGSNML
SAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAK
EKQNAKKAQETK
Download sequence
Identical sequences ENSSSCP00000011518 ENSSSCP00000011518 9823.ENSSSCP00000011515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]