SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011522 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011522
Domain Number 1 Region: 331-403
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000184
Family Growth factor receptor domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011522   Gene: ENSSSCG00000010809   Transcript: ENSSSCT00000011825
Sequence length 693
Comment pep:known_by_projection chromosome:Sscrofa10.2:10:4993529:5184274:1 gene:ENSSSCG00000010809 transcript:ENSSSCT00000011825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFREFGRWKVNNLAVERRNFLGSPLPLAPEFFRNIRLLGRRPTLQQITENLIKKYGTHFL
LSATLGGEESLTIFVDKRKLSKRSEGSDSSTNSSSVTLETLHQLAASYFIDRDSTLRRLH
HIQIASTAIKVTETRTGPLGCSNYDNLDSVSSVLVQSPENKIQLQGLQVLLPDYLQERFV
QAALSYIACNSEGEFICKDNDCWCQCGPKFPECNCPSMDIQAMEENLLRTTETWKAYNMD
FEESDEFKFFMKRLPMNYFLNTSTIMHLWTMDSNFQRRYEQLENSMKQLFLKAQKIVHKL
FSLSKRCHKQPLISLPRQSISRTSTYWLTRIQSFLYCNENGLLGSFSEETHSCTCPNDQV
VCTTFLPCTVGDAAACLTCAPDNRTRCGACNTGYMLSQGLCKPEVAESTDHYIGFETDLQ
DLEMKYLLQKTDRRIEVHAIFISNDMRLNSWFDPSWRKRMLLTLKSNKYKSSLVHMILGL
SLQICLTKNSTLEPVLAVYVNPFGGSHSESWFMPVNENSFPDWERTKLDLPLQCYNWSLT
LGNKWKTFFETVHIYLRSRIKSNGPNGNESIYYEPLEFIDPSRNLGYMKINNIQVFGYSM
HFDPEAIRDLILQLDYPYTQGSQDSALLQLLEIRDRVNKLSPPGQRRLDLFSCLLRHRLK
LSTSEVVRIQAALQAFNAKLPNTVDYDTTKLCS
Download sequence
Identical sequences ENSSSCP00000011522 ENSSSCP00000011522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]