SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011589 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000011589
Domain Number - Region: 203-240
Classification Level Classification E-value
Superfamily Moesin tail domain 0.000157
Family Moesin tail domain 0.01
Further Details:      
 
Domain Number - Region: 95-180
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 0.0553
Family NadC C-terminal domain-like 0.009
Further Details:      
 
Domain Number - Region: 318-429
Classification Level Classification E-value
Superfamily Variant surface glycoprotein (N-terminal domain) 0.0785
Family Variant surface glycoprotein (N-terminal domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011589   Gene: ENSSSCG00000010871   Transcript: ENSSSCT00000011893
Sequence length 448
Comment pep:novel chromosome:Sscrofa10.2:10:18607442:18681061:-1 gene:ENSSSCG00000010871 transcript:ENSSSCT00000011893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTERANRSIHQLKSALREGDVTIGEDVLDPSFGTHVGNEDAGTAWRELQHSHAVNQLKAL
LRQQATEESEVSPRRRKMSPSRSPEHEETNMPTVHNLVAIINDQSQYIHHLEAEVKFCKE
ELSGMKNRVQVVVLENERLQQELKSQKEEEETMREQTLLDASGNVQNSWITPDVDSRVDE
AARRSLSHGNANVINAACAGEAEKWKLELERLKLTYEEKSEILESQLRFLRKELAESQKD
CEDLKERLKHKESLLAANVSHRVGGLCLKCAQHEAVLSQTHSNVHIQTIERLTKERDDLM
SALVSVRSSLTDVQQREASAFEQVKQAVQMTEEANFEKTKALIQCEQLKNELERQTERLE
KELASQQEKRTFEKEMMKKEMTKEREDMRSKVLTLSQNIAQLETQVEKATREKISAVNQL
EEIQNQLASQEMDVTKVCGEMRYQLNKI
Download sequence
Identical sequences ENSSSCP00000011589 9823.ENSSSCP00000011589 ENSSSCP00000011589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]