SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011596 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011596
Domain Number 1 Region: 265-447
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-25
Family SPRY domain 0.023
Further Details:      
 
Domain Number 2 Region: 475-645
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000132
Family Nucleotide and nucleoside kinases 0.02
Further Details:      
 
Domain Number 3 Region: 7-45
Classification Level Classification E-value
Superfamily SAP domain 0.00000000623
Family SAP domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000011596
Domain Number - Region: 161-280
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0314
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011596   Gene: ENSSSCG00000010877   Transcript: ENSSSCT00000011900
Sequence length 789
Comment pep:known_by_projection chromosome:Sscrofa10.2:10:19918406:19928777:1 gene:ENSSSCG00000010877 transcript:ENSSSCT00000011900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSPVNVKKLKVSELKEELKKRRLSDKGLKAELMERLQAALDDEEAGGRPAMEPGNGSL
DLGGDSAERSGAGLEQEAAAGGDEEEEEEEEEEEGIAALDGDQMELGEENGAAGAADSGP
MEEEEAASEDENGDDQGFQEGEDELGEEEEGAGDENGHGEQQPQPPAAPQQQPQQQRGAA
KEAAGKSSGPTSLFAVTVAPPGARQGQQQAGGDGKTEQKGGDKKRGVKRPREDHGRGYFE
YIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFKISRDRLSASSLTMESFAFL
WAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVRIGWSLTTSGMLLGEEEFSY
GYSLKGIKTCNCETEDYGEKFDENDVITCFANFESDEVELSYAKNGQDLGIAFKISKEVL
AERPLFPHVLCHNCAVEFNFGQKEKPYFPIPEEYTFIQNVPLEDRVRGPKGPEEKKDCEV
VMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRA
PQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQK
KAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPP
EKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQR
GGGGGGSGGIGYPYPRGPVFPSRGGYSNRGNYNRGGMPNRGNYNQNFRGRGNNRGYKNQS
QGYNQWQQG
Download sequence
Identical sequences ENSSSCP00000011596 ENSSSCP00000011596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]