SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011774 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011774
Domain Number 1 Region: 354-497
Classification Level Classification E-value
Superfamily C-type lectin-like 8.61e-41
Family C-type lectin domain 0.00038
Further Details:      
 
Domain Number 2 Region: 645-788
Classification Level Classification E-value
Superfamily C-type lectin-like 1.23e-39
Family C-type lectin domain 0.000000327
Further Details:      
 
Domain Number 3 Region: 938-1089
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-39
Family C-type lectin domain 0.00045
Further Details:      
 
Domain Number 4 Region: 796-932
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-38
Family C-type lectin domain 0.00034
Further Details:      
 
Domain Number 5 Region: 1226-1365
Classification Level Classification E-value
Superfamily C-type lectin-like 3.95e-35
Family C-type lectin domain 0.0002
Further Details:      
 
Domain Number 6 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.26e-34
Family Cysteine rich domain 0.00000086
Further Details:      
 
Domain Number 7 Region: 507-645
Classification Level Classification E-value
Superfamily C-type lectin-like 3.37e-31
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 8 Region: 1096-1222
Classification Level Classification E-value
Superfamily C-type lectin-like 3.54e-28
Family C-type lectin domain 0.0024
Further Details:      
 
Domain Number 9 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 5.71e-20
Family Fibronectin type II module 0.00073
Further Details:      
 
Domain Number 10 Region: 230-346
Classification Level Classification E-value
Superfamily C-type lectin-like 1.2e-18
Family C-type lectin domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011774   Gene: ENSSSCG00000011038   Transcript: ENSSSCT00000012082
Sequence length 1462
Comment pep:known_by_projection chromosome:Sscrofa10.2:10:48856012:48960937:1 gene:ENSSSCG00000011038 transcript:ENSSSCT00000012082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSLLYVTTYATILSSFFQTDTRQFLIYNEDHKRCVEALSPSSVQTAVCNQDNEAQKFRW
VSESQIMSVAFKLCLGVPSKTDWVPVTLYACDSKSEFQKWECRNDTLLGIKGEDIFFNYG
NRQEKNIMLYKGSGLWSRWKVYGTTDDLCSRGYEAMYTLLGNSNGATCAFPFKFENKWYA
DCTTAGRSDGWLWCGTTTDYDTDKLFGYCPLKFEGIERLWNKDPLTSISYQINSKSALTW
HQARKSCQQQNAELLSITEIHEQTYLTGLSGTLLTTFGFFLSICSHKFGDRWLKLNEKIF
LTFYFWLSGSPGTEPRGKICMTWNMVKNRFWNDINCGYPNAFICQRHNSSINATVTPTIP
SAPGGCKEGWNFYNDKCFKIFGFVEEERKNWQEARKACIGFGGNLASIRNEKEQENIVNQ
LYLEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCTVMKGKDGYW
ADRACERPLGYICKMKSQAQTPGRVEVETGCRKGWKRHGFYCYLIGHTLSTFAEANQTCE
NEKAYLTTVEDRYEQAFLTSLVGLRPERYFWTGLSDVQNKGTFQWTIAEGVQFTHWNTDM
PGRKAGCVAMRTGVAGGLWDVLRCEEKNKFVCKHWAEGVTRPPEPTTTPEPKCPEDWGTS
SKTSLCFKLFAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQAIWRLVTASGSYHELF
WLGLTYSSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKSDAGMSWNDINCEHLN
NWICQIRKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDKAREFCKKNFG
DLVSIQSESEKKFLWKYVNKNDAQPAYFIGLLISLDKKFIWMDGSKVDYVAWAAGEPNFA
NDDENCVTMYTHSGFWNDINCGYPNAFICQRHNSSINATVTPTIPSAPGGCKEGWNFYND
KCFKIFGFVEEERKNWQEARKACIGFGGNLASIRNEKEQAFLTYHMKDSTFNAWTGLNDV
NSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGKSRDAGKWMDDICDNK
RGYICQTLPDSSLPRSPTTIPTDGFIKYGESSYSLTKLKLQWHEAADYCKLHSSLIASIL
DPYSNAFAWMQMQALSEPVWIALNSNLTNNEYVWTDKWRVRYTNWAADEPRLKTACVYMD
LDGSWKTANCNESFYFFCKKSDETPATEPPQLPGRCPESEHTAWIPFHGHCYYIESSYTR
NWGQASLECLRMGSSLVSIESAAESSFLSYRVEPLQSKTNFWIGLYRNVEGMWLWVNNNP
VSFVNWNTGDPSGERNDCVALYASSGFWNNIHCSSYKGYICKRPKIVDAEPTHALVTTKA
DPRKMVTSKPSSNSAGVVVIVVLLILTGAGFAAYFFYKKRRVHLPQEENFENTLYFNSAS
TPGASDTKDLIGNIEQNEHVVI
Download sequence
Identical sequences ENSSSCP00000011774 ENSSSCP00000011774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]