SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011905 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011905
Domain Number 1 Region: 92-178
Classification Level Classification E-value
Superfamily PUA domain-like 2.55e-19
Family PUA domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000011905
Domain Number - Region: 51-88
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.0981
Family Hypothetical protein APE0525, N-terminal domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011905   Gene: ENSSSCG00000027625   Transcript: ENSSSCT00000012218
Sequence length 181
Comment pep:known chromosome:Sscrofa10.2:10:72133612:72134400:1 gene:ENSSSCG00000027625 transcript:ENSSSCT00000012218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIE
ILTVNGELLFFRQREGPFYPTLRLLHKYPFILPRQQVDKGAIKFVLSGANIMCPGLTSPG
AKLYPAAADTVVAIMAEGKQHALCVGVMKMSAEEIEKVNKGIGIENIHYLNDGLWHMKTY
K
Download sequence
Identical sequences A0A286ZJU5
9823.ENSSSCP00000011895 9823.ENSSSCP00000011905 ENSSSCP00000011895 ENSSSCP00000011905 XP_003482893.1.46622 ENSSSCP00000011895 ENSSSCP00000011905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]