SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011919 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011919
Domain Number 1 Region: 21-333
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.81e-123
Family Papain-like 0.000000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011919   Gene: ENSSSCG00000011171   Transcript: ENSSSCT00000012233
Sequence length 334
Comment pep:known chromosome:Sscrofa10.2:10:76997766:77003512:1 gene:ENSSSCG00000011171 transcript:ENSSSCT00000012233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPSLFLTALCLGIASAAPKLDQNLDADWYKWKATHGRLYGMNEEGWRRAVWEKNMKMIE
LHNQEYSQGKHGFSMAMNAFGDMTNEEFRQVMNGFQNQKHKKGKVFHESLVLEVPKSVDW
REKGYVTAVKNQGQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNG
GLMDNAFQYVKDNGGLDTEESYPYLGRETNSCTYKPECSAANDTGFVDIPQREKALMKAV
ATVGPISVAIDAGHSSFQFYKSGIYYDPDCSSKDLDHGVLVVGYGFEGTDSNSSKFWIVK
NSWGPEWGWNGYVKMAKDQNNHCGISTAASYPTV
Download sequence
Identical sequences Q28944
ENSSSCP00000011919 ENSSSCP00000011919 NP_999057.1.46622 XP_005653866.1.46622 XP_005653867.1.46622 XP_020919720.1.46622 9823.ENSSSCP00000011918 9823.ENSSSCP00000011919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]