SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011963 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011963
Domain Number 1 Region: 171-446
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.1e-93
Family Transglutaminase core 0.00000000024
Further Details:      
 
Domain Number 2 Region: 478-652
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.79e-59
Family Extended PAW domain 0.0000000867
Further Details:      
 
Domain Number 3 Region: 16-116
Classification Level Classification E-value
Superfamily PUG domain-like 7.32e-32
Family PUG domain 0.00000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011963   Gene: ENSSSCG00000011214   Transcript: ENSSSCT00000012280
Sequence length 655
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:14229338:14292192:-1 gene:ENSSSCG00000011214 transcript:ENSSSCT00000012280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTACSRSSSTSTAAPSVAELCQNTPETFLEASKLLLTYADNILRNPNDEKYRSIRIGNTT
FSTRLLPVRGAVECLFEMGFEEGETHLIFPKKASVEQLQKIRDLIAIERSSRLDGSNKSP
KVDVSQQLETSTPLPTTQSSNRNGLTQHPGNSEGQSSNPPSAPMVTGDSVILKVLRSNIQ
HVLVYENLALQEKALACIPVQELKRRSQEKLSRARKLDKGTHLNEEDFLLLELLHWFKEE
FFHWVNDMACSKCGGRTKSRGTSLFPSDDERKWGADRVEDHYCDACQLSNRFPRYNNPEK
LLETRCGRCGEWANCFTLCCRALGFEARYVWDYTADHVWTEVYSPSQQRWLHCDPCEDVC
DKPLLYEIGWGKKLSYVIAFSKDEVVDVTWRYSCKHEEVISRRTKIKEELLRETINGLNK
QRQISLSENRRKELLQRIIVELVEFISPRSPKPGELGGRISGSVAWRVARGEMGPESKEI
LFIPSEEEKISKQLHLCYNTVKNHYVRVSSNNRILDGWENGVWKMESIFRKVETDWNMVY
LARKEGSSYAYISWKFECGSVGLKVDSISIRTSSQTFETGTVQWKLRSDTAQVELTGDKT
LHSYHDFSGATEVILEAELSGGDGGVAWQHTQLFRQSLNDHEENCLEIIIKFIDL
Download sequence
Identical sequences ENSSSCP00000011963 ENSSSCP00000011963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]