SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012051 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000012051
Domain Number - Region: 132-153
Classification Level Classification E-value
Superfamily Plexin repeat 0.0698
Family Plexin repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012051   Gene: ENSSSCG00000011301   Transcript: ENSSSCT00000012374
Sequence length 289
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:30992609:31029396:-1 gene:ENSSSCG00000011301 transcript:ENSSSCT00000012374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIPTHHFRDIERKPEYLQPEKCVPPPHPSPVGTMWFIRDGCGIACAIVTWFLVLYAEFV
VLFVMLIPSRDYVYSIINGIVFNLLAFLALASHCRAMLTDPPPSLPSFLPPSPGAISYLT
SCHGAVPKTGVHFSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALIMV
GFHFLHCFEEDWTKCSSFSPPTTVILLILLCFEGLLFLIFTSVMFGTQVHSICTDETGIE
QLKKEERRWAKKTKWMNMKAVFGHPFSLGWASPFATPDQGKADPYQYVV
Download sequence
Identical sequences ENSSSCP00000012051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]