SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012074 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012074
Domain Number 1 Region: 344-589
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.66e-84
Family Eukaryotic proteases 0.00049
Further Details:      
 
Domain Number 2 Region: 17-248
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.31e-75
Family Eukaryotic proteases 0.0000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012074   Gene: ENSSSCG00000011323   Transcript: ENSSSCT00000012398
Sequence length 591
Comment pep:novel chromosome:Sscrofa10.2:13:32867969:32904503:1 gene:ENSSSCG00000011323 transcript:ENSSSCT00000012398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APEACGKPWWSENLDVTRHWPWEVSLRMENEHVCGGALIDLTWVVTAAHCIQGTKEYSVV
LGTSKLKPTDSMKALLIPVKDIIMHPKYWGRTFILSDIALLQLETPVVISKYVQPICLPE
PNYNLKVGTQCWVTGWGQVKQRFSANFTMTPELQEAEVFIMDNKRCDRIYRKKSLIPRFV
PLVLEDMICATNYGENLCYGDSGGPLACEVEGRWILAGVLSWEKACTKVHNPGVYTRVTK
YSKWIKNYRGTELFLNHPHSPVTSEATTPARDTHHTPSIPRSVSASKGPSQTMGSQPLSA
PGVTAPAASQSTLHTPAPSNVTPLPASAPGTSPSPRPRAAPGGPQPCTCGLRTMRIVGGS
PARARKWPWQVSLQVNDQHMCGGSLIANRWVLTAAHCILGTQNHVEYTVKMGDIHLMNLS
GMAVKIPVRDIVIHKYYNPVGLIENDIALALLDFPVNYSSHIQPVCLPEKTFMVQADTEC
WVTGWGKVDERGNSPLLLQEAELSILRYEKCNEVLKDKMESRLDVVKKGVVCGTSSRGKD
SCQGDSGGPLVCEFNDSWVQVGIVSWGIGCGLRGYPGIYTEVSFYKDWVIA
Download sequence
Identical sequences ENSSSCP00000012074 ENSSSCP00000012074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]