SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012112 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012112
Domain Number 1 Region: 1490-1716
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.82e-43
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 949-1061
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-28
Family Cadherin 0.0007
Further Details:      
 
Domain Number 3 Region: 1733-1943
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-25
Family Laminin G-like module 0.007
Further Details:      
 
Domain Number 4 Region: 1049-1166
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 5 Region: 846-948
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-24
Family Cadherin 0.0016
Further Details:      
 
Domain Number 6 Region: 744-844
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-20
Family Cadherin 0.00086
Further Details:      
 
Domain Number 7 Region: 1429-1469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000168
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 8 Region: 1157-1259
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000614
Family Cadherin 0.01
Further Details:      
 
Domain Number 9 Region: 643-743
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000857
Family Cadherin 0.008
Further Details:      
 
Domain Number 10 Region: 1977-2020
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000746
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 11 Region: 1941-1975
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000018
Family EGF-type module 0.023
Further Details:      
 
Domain Number 12 Region: 2071-2110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000586
Family Laminin-type module 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000012112
Domain Number - Region: 2099-2173
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000889
Family Hormone receptor domain 0.0051
Further Details:      
 
Domain Number - Region: 1408-1434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00779
Family EGF-type module 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012112   Gene: ENSSSCG00000011360   Transcript: ENSSSCT00000012437
Sequence length 3307
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:34596653:34668851:-1 gene:ENSSSCG00000011360 transcript:ENSSSCT00000012437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMARRQPWWGLWGPMTPLLLFLLLLSLFPLSREELGGDGGQDWGPGVAAATGPGARIGGG
ALALCPEPPGVREDGKPGLGVKEPVFVGLQGGRQSTQNGRGPPEEPRLVAEFGVQAVGSR
GRETGQGPGSLLCWRPEVSSCRRTGPLQRDSLSPEALSPGVPGPENSSPFPSDFLVRTRG
SQPVFSQRNTGRGALKKVGTTRCCGELWAPGRRGQSERTATSRPDRPPGAVGSSPVLDSA
PRTGRTALASGSAPRVPDSSEPCERVPRTRGSDNCFLPHEPSACCLRARKESSKPENRQN
SKPRRVRREVPARDSAIPSELTQAGRLLGGLGVVRASDTGHLADSDTGNRGRALYSLTQA
LLTAPLRVGGGDAAAPRLRKPSSCCLEKALFSAPALKLQAQPQGDQIEYGMKALGIWSKS
SVSEVWPLGHLRKSKDQFCTLGPDNIQINRGGGGDPNGAKLSSHSLCPPPPPSPASEPRE
TDEHRTSALQQQGKLDRKHMPSQGLLCSASSECVKVGRFNPNIRFEIVIIPCREADNNNV
ASNSLVSICFQQSVLPHTSVVSVCFEEDKDRNLCLIAYPLKGDLGAVESVDNSDCEPKTS
ASLFDSELDHAISVRVREPGCSPFPAPRELIYLVIVSRSFQCPQLESNIYFKAVLRHCPL
GVPRPHGAAPFPDLTESAAFSYWLCGQGPRAPSLHPSAYHWCGVSGRLTRESVEHYFFGV
EARDHGSPPLSASARVTVTVLDVNDNRPEFTMKEYHLRLNEDATVGTSVVSVTAVDRDAN
SAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRALHDHCYVHI
NITDANTHRPVFQSAHYSVKVNEDQPVGSTVVVISASDDDVGENARITYLLEDNLPQFRI
DADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHY
TGLVSEDAPPFTSVLQISATDRDAHVNGRVQYTFQNGEDGDGDFTIEPTSGIVRTVRWLD
REAVPVYELTAYAVDRGVPPLRTPVSIQVTVQDVNDNAPVFPAEEFEVRVKENSIVGSVV
AQITAVDPDEGPNAHIMYQIVEGNIPELFQMDIFSGELTALIDLDYEARQEYVIVVQATS
APLVSRATVHVRLVDQNDNSPVLNNFQILFNNYVSNRSDTFPSGIIGRIPAYDPDVSDHL
FYSFERGNELQLLVVNQTSGELRLSRKLDNNRPLVASMLVTVTDGLHSVTAQCVLRVVII
TEELLANSLTVRLENMWQERFLSPLLGHFLEGVAAVLATPAEDVFIFNIQNDTDVGGTVL
NVSFSALAPRGAGAGSAGPWFSSEELQEQLYVRRAALAARSLLDVLPFDDNVCLREPCEN
YMKCVSVLRFDSSAPFLASASTLFRPIQPIAGLRCRCPPGFTGDFCETELDLCYSNPCRN
GGACARREGGYTCVCRPRFTGEDCELDTEAGRCVPGVCRNGGTCADGPDGGFRCQCPAGG
AFEGPRCEVAARSFPPSSFVMFRGLRQRFHLTLSLSFATVQPSGLLFYNGRLNEKHDFLA
LELVAGQVRLTYSTGESNTVVSPTVPGGLSDGQWHTVHLRYYNKPRTDALGGAQGPSKDK
VAVLSVDDCDVAVALQFGAEIGNYSCAAAGTQTSSKKSLDLTGPLLLGGVPNLPENFPVS
HKDFVGCMRDLHIDGRQVDMAGFVANNGTMAGCQAKLHFCDSGPCKNSGFCSERWGGFSC
DCPVGFGGKDCRLTMAHPHHFRGNGTLSWDFGNDMAVSVPWYLGLAFRTRATQGVLMQVQ
AGPHSTLLCQLDRGLLSVTVTKGSGRAAHLLLDEVTVSDGRWHDLRLELQEEPGGRRGHH
VLMVSLDFSLFQDTLAVGSELQGLKVKRLHVGGLPPGSEEEAPQGLVGCIQGVWLGSTPL
GSPALLPPSHRVNVEPGCVVTNACASGPCPPHADCRDLWQTFSCTCWPGYYGPGCVDACL
LNPCQNQGSCRHLPGAPLGYTCDCVGGYFGHHCEHRMDQQCPRGWWGSPTCGPCNCDVHK
GFDPNCNKTNGQCHCKEFHYRPRGSDLCLPCDCYPVGSTSRSCAPHSGQCPCRPGALGRQ
CNSCDSPFAEVTASGCQVLYDACPKSLRSGVWWPQTKFGVLASVPCPRGALGAAVRLCDE
DQGWLEPDLFNCTSPAFRELNLLLDGLELNKTVLDTVEAKKLAQRLREVTGHTDHYFSQD
VRVTARLLAHLLAFESHQQGFGLTATQDAHFNENLLWAGSALLAPETGDLWAALGQRSPG
GSPGSAGLVQHLEEYAATLARNMELTYLNPVGLVTPNIMLSIDRMEHPSPTRGTRRYPRY
HSNLFRGQDAWDPHTHVLLPSQAPRPSSPEVLSTSSSTENSTTSSLAPPPVPLDPEPEPG
ISIVILLVYRTLGGLLPAQFQAERRGARLPQNPVMNSPVVSVAVFHGRNFLRGVLESPIS
LEFRLLQTANRSKAICVQWDPPGPADQHGMWTARDCELVHRNGSHARCRCSRTGTFGVLM
DASPRERLEGDLELLAVFTHVVMAVSVAALLLTAAILLSLRSLKSNIRGIHANVAAALGV
AELLFLLGIHRTQNQLVCTVVAILLHYFFLSTFAWLLVQGLHLYRMQVEPRNVDRGAMRF
YHALGWGVPAVLLGLAVGLDPEGYGNPDFCWISVHEPLIWSFAGPVVLVIMMNGTLFLLA
ARTSCSTGQREAKKTSVLTLRSSFLLLLLVSASWLFGLLAVNHSILAFHYLHAGLCGLQG
LVVLLLFCVLNADARAAWTPACLGRKAVPEEARPAPGTGPGAYNNTALFEESGLIRITLG
ASTISSVSSARSGRTQDQDSQRGRSYLRDNVLVRHGSAADHTDHSLQAHAGPTDLDVAMF
HRDAGGGADSDSDSDLSLEEERSLSIPSSESEDNGRAQGRFQRPLHRAAQSERLLTHPKD
MDGNDLLSYWPALGECEAAPCALQTWGSERRLGLDTSKDAANNNQPDLALTSGDETSLGR
AQRQRKGILKNRLQYPLVPQTRGTPELSWCRAATLGHRAVPAASYGRIYAGGGTGSLSQP
ASRYSSREQLDLLLRRQLSREQLEEAPAPVLRPLSRPGSQEHLDAMPGRLEPRDRGSTLP
RRQPPRDYPGTMAACFGSRDALDQGAPCEWLSTLPPPHGVQDLDPQPPPLPLSPQRQLSR
DPLLPSRPLDSLSRRSNSGERLDHVPSQHPSREGLGPPPQLLRVREDPASGPSPSTEQLD
ILSSILASFNSSALSVQSSSTPSGPHTTATPSATASALGPSTPRSATSHSISELSPDSEV
PRSEGHS
Download sequence
Identical sequences ENSSSCP00000012112 ENSSSCP00000012112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]