SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012128 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012128
Domain Number 1 Region: 632-824,1201-1356
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.92e-107
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000386
Further Details:      
 
Domain Number 2 Region: 412-529
Classification Level Classification E-value
Superfamily HSP20-like chaperones 7.15e-36
Family GS domain 0.000000705
Further Details:      
 
Domain Number 3 Region: 158-244
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.00000000000227
Family GS domain 0.033
Further Details:      
 
Domain Number 4 Region: 930-978
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00000000262
Family MYND zinc finger 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012128   Gene: ENSSSCG00000011375   Transcript: ENSSSCT00000012453
Sequence length 1424
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:34958830:34968617:-1 gene:ENSSSCG00000011375 transcript:ENSSSCT00000012453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIRLSVPCWKIWPQRVAKIAGPGRKRRSPDPDAVADPGALWLSTKRLKMSGGASTTGPRR
GPLGLEEATSKKKQKDRANQESKDGDPRRGGSVNPRGLMTFCSSLPVECVGFPSVILSLF
FPLLSGSASAPQEEHTKEEVHGDPHNLFGTPSTELLLDWRQSSDEVIVKLRVGAGPLRLD
EVDAAFTDTDCVVRLPGGRQWGGVFYAEIDGSCTKVQARKGGLLQLSLPKKVPMLMWPSL
LKKPLGTQELVPGLRCQENGQEASPIASEPGPEPRRAKQEARNQKRAQGRSEAGTGAGPG
AQAGPSAKRAVHLRRGPEGEGSRDGPGPRGDAPPFLAEPASTQAEAEEQLRVPPLNPQTC
LLGSEEDLELLTGEKAVSARNDPVSPAMARSRDPEKGDRSKEEMAVAADAATLVDEPESM
VNLAFVKNDSYEKGPDSVVVHVYVKEIRRDTSRVLFREQDFTLIFQTRDGNFLRLHPGCG
PHTTFRWQVKLRNLIEPEQCTFCFTASRIDICLHKRQSQRWGGLEAPAARGAVGGAKVAV
PTGPTPLDSTPPGSAPHPLTGQEEARGVEKEKPKARSEDTGLDGVAARTPMEHVTPKPEP
HLASPKPTCMVPPMPHSPVSGDSVEEEEEEEKKVCLPGFTGLVNLGNTCFMNSVIQSLSN
TRELRDFFHDRSFEAEINYNNPLGTGGRLAIGFAVLLRALWKGTHHAFQPSKLKAIVASK
ASQFTGYAQHDAQEFMAFLLDGLHEDLNRIQNKPYTETVDSDGRPDEVVAEEAWQRHKMR
NDSFIVDLFQGQYKSKLVCPVCAKVSITFDPFLYLPVPLPQKQKVLPVFYFAREPHSKPI
KFLVSISKENSSASEVLDSLSQSVHVKPENLRLAEVIKNRFHRVFLPSHSLDTVSPSDTL
LCFELLSPELAKERVVVLEVQQRPQVPSIPISKCAACQRKQQSEDEKLKRCTRCYRVGYC
NQLCQKTHWPDHKGLCRPENIGYPFLVSVPASRLTYARLAQLLEGYARYSVSVFQPPFQP
GRMALESQGPGCTTMLSTSSLEAGDSERDPVQPPELQLVTPVAEGDTGVPRAWASPDRGP
APSTSGVSSEMLASVSAEVGSLPAGERVSRPEAAVPGYQHPSEAMNAHTPQFFIYKIDAS
NREQRLEDKGDNPLELGEDCSLALVWRNNERLQEFVLVASKELECAEDPGSAGEAARAGH
FTLDQCLNLFTRPEVLAPEEAWYCPQCKQHREASKQLLLWRLPNVLIVQLKRFSFRSFIW
RDKINDLVEFPVRNLDLSKFCIGQKEEQLPSYDLYAVINHYGGMIGGHYTACARLPNDRS
SQRSDVGWRLFDDSTVTTVDESQVVTRYAYVLFYRRRNSPVERPPRAGHSEHHPDLGPAA
ESAASQGLGPGQAPEVAPTRTAPERFAPPVDRPAPTYSNMEEVD
Download sequence
Identical sequences ENSSSCP00000012128 9823.ENSSSCP00000012128 ENSSSCP00000012128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]