SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012135 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012135
Domain Number 1 Region: 299-487,775-922
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.06e-113
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.000000844
Further Details:      
 
Domain Number 2 Region: 9-123
Classification Level Classification E-value
Superfamily DUSP-like 1.7e-39
Family DUSP, domain in ubiquitin-specific proteases 0.00000306
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000012135
Domain Number - Region: 152-221
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0568
Family Ubiquitin-related 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012135   Gene: ENSSSCG00000011382   Transcript: ENSSSCT00000012460
Sequence length 963
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:35080259:35135384:-1 gene:ENSSSCG00000011382 transcript:ENSSSCT00000012460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGGGCRERPDAETQKSELGALMRTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVG
EHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRK
VVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERE
TRLWNRYMSNTYEQLSKLDNTVQDAGLYQGQVLVIEPQNEDGTWPRQTLQSKSSTVPSRN
FTTSPKSSASPYSSVSASPIANGDSTNTSGMHSSGVSRGGSGFSASYNCQESPSSHVQPG
LCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIK
QMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLEL
KDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKISVTFDPFCYLTLP
LPLKKDRVMEIFLVPADPHCRPTQYRVIVPLMGAVSDLCEALSRLSGVAAENMVVTDVYN
HRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSMDGSECITLPVYFRERKSRPSSTSTGAVL
YGQPLLVSVPKHKLTLEFLYQAVCERISRYIKQPLPDESGSSPLEPGACNGSRGSCEGED
EEEMEHQEEGREQLSETEGSGEDESGSDRGETSQKKLKDRPCPERLFTFSLVNSYGTADI
NSLATDGKLLKLNSRSTLAIDWDSETRNRYYDEQESEAYEKHVSMLQPQKKKKTAVALRD
CIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDT
VVEFPVRALNMSEFVCDLSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDS
NVSLASEDQIVTKAAYVLFYQRRDDEFYKAPSLSFPGSSDGGTRPGSSQQGMGDDETCSM
DTN
Download sequence
Identical sequences A0A287AEJ8
ENSSSCP00000012135 ENSSSCP00000012135 NP_001230117.1.46622 XP_013837095.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]