SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012140 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012140
Domain Number 1 Region: 96-268
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-35
Family SPRY domain 0.005
Further Details:      
 
Domain Number 2 Region: 1246-1298
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000328
Family RING finger domain, C3HC4 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000012140
Domain Number - Region: 782-952
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 0.0759
Family Tex N-terminal region-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012140   Gene: ENSSSCG00000011387   Transcript: ENSSSCT00000012465
Sequence length 1314
Comment pep:known chromosome:Sscrofa10.2:13:35399968:35429697:1 gene:ENSSSCG00000011387 transcript:ENSSSCT00000012465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKGAGMSFSRKSYRLTSDAEKSRVTGIVHEKLLNDYLHRIFSSADHASTTATSRKPLN
FQNLPEHLDQLLRVDDEEEESQGQVEGRLGPSTVVLDHTGGFEGLLLVDDDLLGVIGHSN
FGTIRSTTCVYKGKWVYEVLISSQGLMQIGWCTINCRFNQEEGVGDTHNSYAYDGNRVRK
WNVTTTNYGKAWAAGDIVSCLIDLDDGTLSFCLNGVSLGTAFENLSRGLGMAYFPAISLS
FKESVAFNFGSRPLRYPLAGYRPLQDPPRADLVRAQKLLGCFQAVLSVELDPTEGQLLEK
ESSEWQLQGQPTILLTLAHIFHRFAPLLRKVYLVEAVLMSFLLGIVEGGTPAQAQSMVHQ
VLDLLWLFMEDYEVQDCLKQSMMSLLRLYRFSPIVPDLGLQIRYLQLTIAILSHEKSRKF
LLSNVLFDVLRSVVFFYIKSPLRVEEAGLQELIPTTWWPHRSGREGKESKEVKDETSEER
LRRRAYERGCQRLKKRIEVVEELQVQILKLLLNNKDDNGGEASRYIFLTKFRKFLQENAS
SRGNMPMLCPPEYMVCFLHRLISALRYYWDEYKASNPRASFSEEAYIPPQVFYNGKVDYF
DLQRLGGLLSHLRKTLKDDLASKANILIDPLELQAATMDDLDEDEEPAPAAAQRPMQALA
VGGALPLPRPGWLSSPTLGRANRFLSTAAVSLMTPRRPLSTSEKVKVRTLSAEQRTREDI
EGSHWNEGLLLGRPPEEPEQPLTENSLLEVLDGAIMMYNLSVHQQLGKMVGVSDDVNEYA
MALRDTEDKLRRCPKRRKDILAELTKSQKVFSEKLDHLSRRLAWVHATVYSQEKMQDIYW
LLRVCLRTIEHGDRTGPLFAFMPEFYLSVAINSYSALKNYFGPVHSMEELTGYEETLTRL
AAILAKHFADTRIVGTDIRDSLMQALASYVCYPNSLRAVERIPEEQRIAMVRSLLAPYEQ
RPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPEDANLPSLQKPCPSTLLQQHMADLLR
EGPDVAPSFLNSVLNQLNWAFSEFIGMIQEIQQAAERLERNFVDSRQLKVCATCFDLSVS
LLRVLEMTITLVPEIFLDWARPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGL
ESVDHYPILVAVTGILVRLLVHGPASGIERATSVLLADPCFQLRSICYLLGQSEPPTPGT
ALSAPDRKHFSLQSYTDYISVEELAQVEQMLAHLTTASAQAAAASLPTSEEDLCPICYAH
PISAVFQPCGHKSCKACINQHLMNNKDCFFCKATIVSVEDWDKAANASATSSAA
Download sequence
Identical sequences 9823.ENSSSCP00000012140 ENSSSCP00000012140 ENSSSCP00000012140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]