SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012190 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012190
Domain Number 1 Region: 1-236
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.01e-61
Family Ubiquitin carboxyl-terminal hydrolase UCH-L 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012190   Gene: ENSSSCG00000011438   Transcript: ENSSSCT00000012518
Sequence length 729
Comment pep:known chromosome:Sscrofa10.2:13:37759259:37767127:-1 gene:ENSSSCG00000011438 transcript:ENSSSCT00000012518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRR
KVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSSVDLGPTLSRMKDFTK
GFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIK
YEARLHVLKVNRQTILESLQQLIRVTQPELIQTHKSQESQLPEESKPVSSKSPLSVEANR
ASVASEGTHTDGVEEVAGSCPQALTHSPPSKPKLMVKPPGSSLNGVPPNPTPIVQRLPAF
LDNHNYAKSPMQEEEDLAAGVGRSRVPIRPPQQYSDDEDDYEDDEEDDMQNTNSAIRYKR
KGPGKPGPLSGSGDGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPT
HSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLR
VDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTESGKGSSPSVRLSQSSHGSGSPEE
KDMVEAMDGREKPGLVRPGEPLSGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKF
KIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKR
SRPYKAKRQ
Download sequence
Identical sequences A0A286ZQN6
XP_001925271.3.46622 ENSSSCP00000012190 9823.ENSSSCP00000012190 ENSSSCP00000012190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]