SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012221 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012221
Domain Number 1 Region: 6-110
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.15e-20
Family FHA domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012221   Gene: ENSSSCG00000011468   Transcript: ENSSSCT00000012550
Sequence length 287
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:43455340:43545275:-1 gene:ENSSSCG00000011468 transcript:ENSSSCT00000012550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSALAIFTCRPNSHPFQERHVYLDEPIKIGRSVARCRPAQNNATFDCKVLSRNHALVWF
DHKTGKFYLQDTKSSNGTFINSQRLSRGSEESPPCEILSGDIIQFGVDVTENTRKVTHGC
IVSTIKLFLPDGMEARLRSDVIHAPLPSPVDKVAANTPSMYSQELFQLSQYLQEALHREQ
MLEQKLATLQRLLAITQEASDTSWQALIDEDRLLSRLEVMGNQLQACSKNQTEDSLRKEL
IALQEDKHNYETTAKESLRRVLQEKIDVVRKLSEVEVFKFYKYSIVV
Download sequence
Identical sequences ENSSSCP00000012221 ENSSSCP00000012221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]