SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012366 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012366
Domain Number 1 Region: 208-323,535-651
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.72e-48
Family Transglutaminase core 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012366   Gene: ENSSSCG00000011602   Transcript: ENSSSCT00000012699
Sequence length 944
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:77746497:77798834:1 gene:ENSSSCG00000011602 transcript:ENSSSCT00000012699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKRSAGRAPRGRKLRGQKAKGEGKARREEKEADVSEDEKPLKKSLLSKVSRGKRKSSC
GASGGPAAGPARKKVARATVKLETPQVVKDEALSDEDDFRDFTSARKKTHLPKKEAAVDT
GACEGDAEEDSEDDWEEVEELTEPVPGGLGENTAFSKSAVPVKPVEIEIETPEQVKARER
SEKIKMEFETQLRRMMKRFNKEVHEDTHKVHLLCLLANGFYRNSICSQPDLRAIGLSIIP
TRFTKVPPQDVDVCYLSNLVKWFIGTFTVNADLSTNEQDGLQTTLERRFAIYSARDDEEL
VHIFLLIIRALHLSARLVLSLQPIPLKSSAAKGKKASKERSTEGPGCSSETSSPGPAKQT
KLKSSSGNRREDPSSEGTSGPRAKGKGSKAAAATKKQREPSSSGEEEGKAAGQQGEARRP
ARGRRRQAATRVSYKEESGSDKASSSSDFELSSGDSHCPSDEDSEPGLRRQRRAPGLPRT
KAGAKSDSRSQRGSHPKPPGFLAASAGPPGSKRKGGKKTSVRGEEADGGKVAGVDHWLEV
FCEREDKWVCVDCVHGVVGQPLTCYQYATKPMTYVVGIDGDGWVRDVTQRYDPAWMTATR
KCRVDAVWWAETLRPYRSPLLEREQREDQEFQAKHLDQPMPTVIGTYKNHPLYALKRHLL
KYEAIYPETAAILGYCRGEAVYSRDCVHTLHSRDTWLKQGRVVRLGEVPYKMVKGYSNRA
RKARLAEPQLRDHNDLPLFGQWQTEEYQPPVAVDGKVPRNEFGNVYLFLPSMMPVGCVQL
NLPNLQRVARKLNIDCVQAITGFDFHKGYSHPITDGYIVCEEYRDILLAAWENEQALIEK
KEKEKKEKRTLGNWKLLVKGLLIRERLRLRYGTQSKTAAPHTDTGGLSSDEEEGTSSQGE
AARILAASWPQNREAEEERERKCPKRTRREKKEAASHLFPFEKM
Download sequence
Identical sequences F1SPI2
XP_003132441.1.46622 ENSSSCP00000012366 9823.ENSSSCP00000012366 ENSSSCP00000012366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]