SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012373 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012373
Domain Number 1 Region: 880-1024
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-18
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 987-1111
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000408
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 3 Region: 773-907
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000121
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 709-769
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000452
Family EGF-type module 0.009
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000012373
Domain Number - Region: 130-174
Classification Level Classification E-value
Superfamily FnI-like domain 0.00146
Family VWC domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012373   Gene: ENSSSCG00000011609   Transcript: ENSSSCT00000012706
Sequence length 1222
Comment pep:novel chromosome:Sscrofa10.2:13:78256434:78359474:-1 gene:ENSSSCG00000011609 transcript:ENSSSCT00000012706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLLREPGGTWLALALALALGTGSGMAAPGQDCTGIECPPLENCIEEALEPGECCATCVQ
RGCACEGYQYYDCLQGGFVRGRVPAGQSYFVDFGSTECSCPPGGGKISCQFMLCPELPPN
CIEAVVVADSCPQCGQVGCIHSGRKYAAGHTVHLSPCRACHCPDAGGELICYQLPDCDGD
AEAELATATGNFSDAEEGDPERHYEDPYSYDQEVAEAEAAEALAGELQAGTGGPAALGGG
RQPPSSIQATPWPVALPRPTAATALGPPAPVQAKARRVTEDRQEREELTHREQPAAGGPR
GLGGLPTAGPVGPDLPVQEEGAEARAWPEENLIPDAQATPGSTGQEGAGPVPASSTPSVL
SSQAASSPEVPTEPSTHTSLTIPRQEAAQAPPTQEVPKQPPVLPRSQPEDPDPNSVHSVP
RGDPEASGTYILVEGGCGLSQAMKKQVDSRQVAPLGSSHASFCTIVLRTVKCCIQSLQPK
SFTVGLGGGKEGVVCLSLEAEDTFGNSLYKEGQGCHGLGDAPRRHGASQPCPQGPLCFFP
CENIRSSSAMGEHQVLDPSVKAESQTFTAPSLVSEQHREFAIQLPGSPLASGRDVLPEDH
RQALPSVLAPSMAGTAIELQKDACSSGFKPIAGDSSTCRFQSSAIFPESARLPYLPSSST
AQAASCLFSLLCPQERGSGHNAPSHACLVQGDTAGPSNSPLFFLPRLSLDQDECLLGAHD
CSRRQFCVNTLGSFYCVNHTVLCAEGFLLNPHRKCVDINECVTDMHTCSRSEHCVNTVGS
FRCYKALTCEPGYMLKDGECTDVDECELGTHSCQVGFTCQNTKGSFYCQPRQRCMDGFLQ
DPEGNCVDINECTSLSEPCQPGFSCVNTVGSYTCQRNPLICGRGYHASQDGTKCVDVNEC
ETGVHHCSETQVCHNLPGSYRCDCKAGFQRDAFGRTCIDVNECWASPSRLCQHTCENTLG
SYRCSCASGFVLAADGKHCEDVNECEAQRCSQECANIYGSYQCYCRQGYQLAEDGHTCID
IDECAQGAGVLCTFRCINVPGSYQCACPERGYTMTANGRSCKDLDECALGTHNCSEAETC
HNIQGSFRCLRFDCPPNYVRVSETKCERTLCQDFVECQNAPARITHYRLNFQTGLLVPAH
IFRISPVPAFAGDTIALTITKGNEEGYFGTRRLNAYTGVVFLQRSVREPRDFALDVEMKL
WRQGSVTTFLAKMHIFFTTFAL
Download sequence
Identical sequences ENSSSCP00000012373 ENSSSCP00000012373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]