SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012406 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012406
Domain Number 1 Region: 361-705
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.87e-135
Family Transferrin 0.00000000000245
Further Details:      
 
Domain Number 2 Region: 23-350
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.2e-132
Family Transferrin 0.00000000000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012406   Gene: ENSSSCG00000011640   Transcript: ENSSSCT00000012740
Sequence length 715
Comment pep:novel chromosome:Sscrofa10.2:13:82429036:82469005:1 gene:ENSSSCG00000011640 transcript:ENSSSCT00000012740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLAVRALLACAVLGLSLAVAQKTVRWCTISNQEANKCSSFRENMSKAVKNGPLVSCVKK
SSYLDCIKAIRDKEADAVTLDAGLVFEAGLAPYNLKPVVAEFYGQKDNPQTHYYAVAVVK
KGSNFQWNQLQGKRSCHTGLGRSAGWIIPMGLLYDQLPEPRKPIEKAVASFFSSSCVPCA
DPVNFPKLCQQCAGKGAEKCACSNHEPYFGYAGAFNCLKEDAGDVAFVKHSTVLENLPDK
ADRDQYELLCRDNTRRPVDDYENCYLAQVPSHAVVARSVDGQEDSIWELLNQAQEHFGRD
KSPDFQLFSSSHGKDLLFKDSANGFLRIPSKMDSSLYLGYQYVTALRNLREEISPDSSKN
ECKKVRWCAIGHEETQKCDAWSINSGGKIECVSAENTEDCIAKIVKGEADAMSLDGGYIY
IAGKCGLVPVLAENYKTEGENCVNTPEKGYLAVAVVKKSSGPDLNWNNLKGKKSCHTAVD
RTAGWNIPMGLLYNKINSCKFDQFFGEGCAPGSQRNSSLCALCIGSERAPGRECLANNHE
RYYGYTGAFRCLVEKGDVAFVKDQVVQQNTDGKNKDDWAKDLKQMDFELLCQNGAREPVD
NAENCHLARAPNHAVVARDDKVTCVAEELLKQQAQFGRHVTDCSSSFCMFKSNTKDLLFR
DDTQCLARVGKTTYESYLGADYITAVANLRKCSTSKLLEACTFHSAKNPRVETTT
Download sequence
Identical sequences B3CL06
NP_001231582.1.46622 ENSSSCP00000012406 ENSSSCP00000012406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]