SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012414 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012414
Domain Number 1 Region: 166-287
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.66e-26
Family Transglutaminase core 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012414   Gene: ENSSSCG00000011646   Transcript: ENSSSCT00000012748
Sequence length 662
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:83261534:83308188:-1 gene:ENSSSCG00000011646 transcript:ENSSSCT00000012748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELKKDSNSVSIDMLLIVHSEKRRAAQGAHSDRQTDPGAPPQRRGGLQGIGNGIRRWQKL
EGSDLHGNLVEKQHLQQTQVITSYDNQGTQLTVEVHPRDAMPQLLKKFSLAKRLQGDKNG
NTRPRQPGGKDAHAYPWDRSSLKSMPLDLRQFEKLDAYASQVMVKSGLDELVSDLLQEAH
SDLERVRAIWIWICHHIEYDIEAAQEKDRQAFKPTTILQTQKTNCDGYAGLFERMCRIAG
VQCMTVPGYSKGFGYQPGQSFSGEFDHAWNAVYLEGRWHLVDSTWGSGLVDSATSKFTFL
YNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENNMYHKSEFYNKGMLSAHPETSI
IKTVNGKATVTIESCAPTLFMFMLNGKQEHGLLSLRKNGMKLDVYPPTVGTHKLQIFAKG
NSEIYSSVLEYTLKCHYADIDVRLPAELHQPVGPSWFSEQMGITKPSHPEPVIYTSDGRC
SISFGVEEGISVLASLHGDDGPITEETQRRYIFQLHREKHTELKVQLPHAGKFALKIFVK
KRQEPGNYIFVFNYLLCCTNTKVNWPVFPESFGNWGQDNELLEPLSGVLPANRNVPFKLK
LHGVAKALVKGQDTWPLTLNREGYWEGSCSTAGCQEVYVMVLENANHNFYSYILKYKVND
TQ
Download sequence
Identical sequences ENSSSCP00000012414 ENSSSCP00000012414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]