SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012497 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012497
Domain Number 1 Region: 180-368
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-34
Family Pentraxin (pentaxin) 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012497   Gene: ENSSSCG00000011727   Transcript: ENSSSCT00000012837
Sequence length 382
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:105440738:105446892:1 gene:ENSSSCG00000011727 transcript:ENSSSCT00000012837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPAILFCALWSAVLAENSDDYELMYVNLDNEIDNGLHPTEDPTLCDCSPEHSEWDKLF
IMLENSQMRESMLLQATDDILRGELQRLRAELGRLAGSLARPCAPTAPAEVQLARALDEL
LQASRDAGRRLERLEEAGTPQLQEEAGRTLGAVLEELRRTRADLRAVQGWAAGRWLPAGC
ETAILFPMRSKKIFASVHPATPMKLEAFSACIWVKATDVLNKTILFSYGTKRNPYEIQLY
LSYQSTVLVVGGEENRLVANTVISPGTWTHLCSTWNSEQGHVALWVNGDLIATKVDMATG
HIVPEGGILQIGQEKNGCCVGGGFDEILAFSGRLTGFNIWDRVLSTEEIKKTGGAESCHI
RGNVVGWGVTEIQPHGGAQYVS
Download sequence
Identical sequences F1SJM0
ENSSSCP00000012497 ENSSSCP00000012497 9823.ENSSSCP00000012497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]